1. GPCR/G Protein Neuronal Signaling
  2. Neuropeptide Y Receptor
  3. Peptide YY (PYY), human

Peptide YY (PYY) is a gut hormone that regulates appetite and inhibits pancreatic secretion. Peptide YY (PYY) can mediate its effects through the Neuropeptide Y receptors.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Peptide YY (PYY), human Chemical Structure

Peptide YY (PYY), human Chemical Structure

CAS No. : 118997-30-1

Size Price Stock Quantity
1 mg USD 80 In-stock
5 mg USD 240 In-stock
10 mg USD 385 In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Top Publications Citing Use of Products
  • Biological Activity

  • Protocol

  • Purity & Documentation

  • References

  • Customer Review

Description

Peptide YY (PYY) is a gut hormone that regulates appetite and inhibits pancreatic secretion. Peptide YY (PYY) can mediate its effects through the Neuropeptide Y receptors.

IC50 & Target

Neuropeptide Y receptor[1]

In Vitro

The gut hormone peptide YY ( PYY) belongs to the pancreatic polypeptide (PP) family along with PP and neuropeptide Y (NPY). These peptides mediate their effects through the NPY receptors of which there are several subtypes (Y1, Y2, Y4, and Y5)[1]. Pancreatic polypeptide YY (Peptide YY), a small peptide consisting of 36 amino acids, is originally isolated from porcine intestine and is secreted from the neuroendocrine cells (L cells) in the mucosa of the gastrointestinal tract, but it has been localized to other locations associated with the digestive system[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

Peptide YY is capable of strongly inhibiting secretin-stimulated pancreatic secretion. A very low dose of Peptide YY (10-20 pmol/kg) significantly decreases the pancreatic secretion of bicarbonate as well as fluid that is stimulated by a single dose of secretin (0.1 unit/kg). A dose of Peptide YY of 100-200 pmol/kg causes a 70-80% reduction of the pancreatic bicarbonate and fluid secretion[3]. Peptide YY is localised to blood vessels and atherosclerotic plaques of rabbits. It causes vasoconstriction of the vascular tree[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

4309.75

Formula

C194H295N55O57

CAS No.
Unlabeled CAS

Appearance

Solid

Color

White to off-white

Sequence

Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2

Sequence Shortening

YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture and light, under nitrogen

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

Solvent & Solubility
In Vitro: 

H2O : 100 mg/mL (23.20 mM; Need ultrasonic)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2320 mL 1.1602 mL 2.3203 mL
5 mM 0.0464 mL 0.2320 mL 0.4641 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Purity & Documentation
References
Animal Administration
[2][3]

Cats[3]

The inhibitory effects of Peptide YY on pancreatic exocrine secretion are studied by using an anesthetized adult (4 kg) cat. Infusion of secretin and CCK (1.5 units/ kg/hr each) in saline solution is made through the saphenous vein by using a perfusion pump at a flow rate of 10 ml/hr. Infusion or single injection of Peptide YY (10-250 pmol/kg) is also made through the saphenous vein. Pancreatic juice from the cannulated pancreatic duct is collected in test tubes for 10-min periods by using a fraction collector. The volume of the juice and A280 are measured. Bicarbonate is determined by the titration method[3].

Rabbits[2]

New Zealand White rabbits are fed an atherogenic diet and control animals fed a normal diet for 4 weeks. Immunohistochemistry is used to determine the localization of Peptide YY and eNOS in the aorta. The aorta, carotid, renal, iliac, inferior mesenteric, and renal interlobular arteries are removed, mounted in organ baths, and subjected to doses of Peptide YY (1-100 nM) and then acetylcholine (1 μM)[2].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
H2O 1 mM 0.2320 mL 1.1602 mL 2.3203 mL 5.8008 mL
5 mM 0.0464 mL 0.2320 mL 0.4641 mL 1.1602 mL
10 mM 0.0232 mL 0.1160 mL 0.2320 mL 0.5801 mL
15 mM 0.0155 mL 0.0773 mL 0.1547 mL 0.3867 mL
20 mM 0.0116 mL 0.0580 mL 0.1160 mL 0.2900 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Peptide YY (PYY), human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Peptide YY (PYY), human
Cat. No.:
HY-P1514
Quantity:
MCE Japan Authorized Agent: