1. GPCR/G Protein Neuronal Signaling
  2. Opioid Receptor
  3. β-Endorphin, human

β-Endorphin, human, a prominent endogenous peptide, existing in the hypophysis cerebri and hypothalamus, is an agonist of opioid receptor, with preferred affinity for μ-opioid receptor and δ-opioid receptor; β-Endorphin, human exhibits antinociception activity.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

β-Endorphin, human Chemical Structure

β-Endorphin, human Chemical Structure

CAS No. : 61214-51-5

Size Price Stock Quantity
1 mg USD 140 In-stock
5 mg USD 420 In-stock
10 mg USD 670 In-stock
25 mg USD 1340 In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of β-Endorphin, human:

Top Publications Citing Use of Products

1 Publications Citing Use of MCE β-Endorphin, human

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

β-Endorphin, human, a prominent endogenous peptide, existing in the hypophysis cerebri and hypothalamus, is an agonist of opioid receptor, with preferred affinity for μ-opioid receptor and δ-opioid receptor; β-Endorphin, human exhibits antinociception activity.

IC50 & Target

δ Opioid Receptor/DOR

 

In Vitro

β-Endorphin, human is an agonist of opioid receptor, with preferred affinity for μ-opioid receptor and δ-opioid receptor. β-Endorphin exhibits anti-nociception activity by stimulating ε-opioid receptor, rather than μ-, δ-, and κ-opioid receptor[1]. β-Endorphin has anti-nociception activity. Firstly, β-Endorphin combines together with the opioid receptors in hyperalgesia. Further, β-Endorphin suppresses the release of substance P at the level of spinal cord and blocks the conduction of pain on the primary sensory neurons. Moreover, β-Endorphin activates the endogenous analgesia system located in the CNS. In addition, β-Endorphin inhibits the conduction of pain and agitation of nociceptors to exert an analgesic effect[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

3464.98

Formula

C158H251N39O46S

CAS No.
Unlabeled CAS

Appearance

Solid

Color

White to off-white

Sequence

Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu

Sequence Shortening

YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility
In Vitro: 

DMSO : 100 mg/mL (28.86 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

H2O : ≥ 50 mg/mL (14.43 mM)

*"≥" means soluble, but saturation unknown.

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2886 mL 1.4430 mL 2.8860 mL
5 mM 0.0577 mL 0.2886 mL 0.5772 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Purity & Documentation

Purity: 97.04%

References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
H2O / DMSO 1 mM 0.2886 mL 1.4430 mL 2.8860 mL 7.2150 mL
5 mM 0.0577 mL 0.2886 mL 0.5772 mL 1.4430 mL
10 mM 0.0289 mL 0.1443 mL 0.2886 mL 0.7215 mL
DMSO 15 mM 0.0192 mL 0.0962 mL 0.1924 mL 0.4810 mL
20 mM 0.0144 mL 0.0722 mL 0.1443 mL 0.3608 mL
25 mM 0.0115 mL 0.0577 mL 0.1154 mL 0.2886 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

β-Endorphin, human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
β-Endorphin, human
Cat. No.:
HY-P1502
Quantity:
MCE Japan Authorized Agent: