1. Anti-infection
  2. Bacterial
  3. Beta-defensin 103 isoform X1, pig

Beta-defensin 103 isoform X1, pig is an antimicrobial peptide found in different living organisms, involved in the first line of defense in their innate immune response against pathogens.

For research use only. We do not sell to patients.

Beta-defensin 103 isoform X1, pig Chemical Structure

Beta-defensin 103 isoform X1, pig Chemical Structure

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Beta-defensin 103 isoform X1, pig is an antimicrobial peptide found in different living organisms, involved in the first line of defense in their innate immune response against pathogens[1].

In Vitro

The defensin family comprises three subfamilies (α-, β- and θ-defensins) and is one of the groups of antimicrobial peptides involved in the innate immune response, being a part of the nonspecific way in which many living organisms react against invading pathogens[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

7790.54

Formula

C346H575N105O83S8

Unlabeled CAS

Sequence

Met-Arg-Ile-His-Tyr-Leu-Leu-Phe-Ala-Leu-Leu-Phe-Leu-Phe-Leu-Met-Pro-Leu-Pro-Gly-Asn-Gly-Arg-Ile-Ile-Asn-Thr-Leu-Gln-Arg-Tyr-Tyr-Cys-Lys-Ile-Arg-Arg-Gly-Arg-Cys-Ala-Val-Leu-Gly-Cys-Leu-Pro-Lys-Glu-Glu-Gln-Ile-Gly-Ser-Cys-Ser-Val-Ser-Gly-Arg-Lys-Cys-Cys-Arg-Lys-Arg-Lys

Sequence Shortening

MRIHYLLFALLFLFLMPLPGNGRIINTLQRYYCKIRRGRCAVLGCLPKEEQIGSCSVSGRKCCRKRK

SMILES

O=C(N[C@@H](CCCNC(N)=N)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CC1=CNC=N1)C(N[C@@H](CC2=CC=C(C=C2)O)C(N[C@@H](CC(C)C)C(N[C@@H](CC(C)C)C(N[C@@H](CC3=CC=CC=C3)C(N[C@@H](C)C(N[C@@H](CC(C)C)C(N[C@@H](CC(C)C)C(N[C@@H](CC4=CC=CC=C4)C(N[C@@H](CC(C)C)C(N[C@@H](CC5=CC=CC=C5)C(N[C@@H](CC(C)C)C(N[C@@H](CCSC)C(N6[C@@H](CCC6)C(N[C@@H](CC(C)C)C(N7[C@@H](CCC7)C(NCC(N[C@@H](CC(N)=O)C(NCC(N[C@@H](CCCNC(N)=N)C(N[C@@H]([C@@H](C)CC)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CC(N)=O)C(N[C@@H]([C@H](O)C)C(N[C@@H](CC(C)C)C(N[C@@H](CCC(N)=O)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CC8=CC=C(C=C8)O)C(N[C@@H](CC9=CC=C(C=C9)O)C(N[C@@H](CS)C(N[C@@H](CCCCN)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCNC(N)=N)C(NCC(N[C@@H](CCCNC(N)=N)C(N[C@@H](CS)C(N[C@@H](C)C(N[C@@H](C(C)C)C(N[C@@H](CC(C)C)C(NCC(N[C@@H](CS)C(N[C@@H](CC(C)C)C(N%10[C@@H](CCC%10)C(N[C@@H](CCCCN)C(N[C@@H](CCC(O)=O)C(N[C@@H](CCC(O)=O)C(N[C@@H](CCC(N)=O)C(N[C@@H]([C@@H](C)CC)C(NCC(N[C@@H](CO)C(N[C@@H](CS)C(N[C@@H](CO)C(N[C@@H](C(C)C)C(N[C@@H](CO)C(NCC(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCCN)C(N[C@@H](CS)C(N[C@@H](CS)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCCN)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCCN)C(O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)[C@H](CCSC)N

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Beta-defensin 103 isoform X1, pig Related Classifications

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Beta-defensin 103 isoform X1, pig
Cat. No.:
HY-P2291
Quantity:
MCE Japan Authorized Agent: