1. GPCR/G Protein Neuronal Signaling
  2. Opioid Receptor
  3. β-Endorphin, equine TFA

β-Endorphin, equine TFA is an endogenous opioid peptide, which binds at high affinity to both μ/δ opioid receptors. β-Endorphin, equine TFA has analgesic properties.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

β-Endorphin, equine TFA Chemical Structure

β-Endorphin, equine TFA Chemical Structure

Size Price Stock Quantity
500 μg USD 90 In-stock
1 mg USD 150 In-stock
5 mg USD 350 In-stock
10 mg USD 600 In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of β-Endorphin, equine TFA:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

β-Endorphin, equine TFA is an endogenous opioid peptide, which binds at high affinity to both μ/δ opioid receptors. β-Endorphin, equine TFA has analgesic properties[1][2][3][4].

IC50 & Target

δ Opioid Receptor/DOR

 

μ Opioid Receptor/MOR

 

In Vitro

β-Endorphin, equine TFA (0, 0.6, 1.2 and 3 μM) inhibits the striatal dopamine release[4].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

β-Endorphin, equine TFA (2 or 20 μg/kg; i.p., once) effects the acquisition and retention in the rat[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Adult Female Wistar rats[3]
Dosage: 2 or 20 μg/kg
Administration: 2 or 20 μg/kg; i.p., once
Result: Hindered the acquisition of shuttle avoidance learning and habituation of a rearing response to a tone at a dose of 20 μg/kg. Caused amnesia in the avoidance task with the pre- or post-training administration of 2 μg/kg and pre-training administration of 20 μg/kg.
Molecular Weight

3423.94 (free acid)

Formula

C154H248N42O44S.xC2HF3O2

Unlabeled CAS

Appearance

Solid

Color

White to off-white

Sequence

Tyr-Gly-Gly-Phe-Met-Ser-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-His-Lys-Lys-Gly-Gln

Sequence Shortening

YGGFMSSEKSQTPLVTLFKNAIIKNAHKKGQ

Structure Classification
Initial Source
Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility
In Vitro: 

H2O : 100 mg/mL (Need ultrasonic)

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
β-Endorphin, equine TFA
Cat. No.:
HY-P1866A
Quantity:
MCE Japan Authorized Agent: