2. Peptides
  3. Peptide and Derivatives
  4. Hormones and Neuropeptides
  5. Big Gastrin I (human) (TFA)

Big Gastrin I, human (TFA) is a gastrointestinal hormone consisting of 34 amino acids. Big Gastrin I, human (TFA) can be used as a potential substance for the study of cancer, autoimmune diseases, fibrotic diseases, inflammatory diseases, neurological diseases or cardiovascular diseases.

For research use only. We do not sell to patients.

Big Gastrin I (human) (TFA) Chemical Structure

Big Gastrin I (human) (TFA) Chemical Structure

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Big Gastrin I (human) (TFA) Related Antibodies

Top Publications Citing Use of Products

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Big Gastrin I, human (TFA) is a gastrointestinal hormone consisting of 34 amino acids. Big Gastrin I, human (TFA) can be used as a potential substance for the study of cancer, autoimmune diseases, fibrotic diseases, inflammatory diseases, neurological diseases or cardiovascular diseases[1].

In Vitro

Big Gastrin I, human (TFA) (10 μg/mL, 6 days) inhibits 11.3% of HBV replication in HepG2 cells containing the hepatitis B virus (HBV) ayw strain genome and maintains cell viability at 88.7%[1].
Big Gastrin I, human (TFA) (10 μg/mL, 24 h) can arrest cells mainly in G0/G1 phase and induces apoptosis in human A549 cells[1].
Big Gastrin I, human (TFA) (10 μg/mL, 22 h) can inhibit 35% of cell migration in human endothelial cells (HUVEC)[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Big Gastrin I (human) (TFA) Related Antibodies

Cell Cycle Analysis[1]

Cell Line: Human A549 cells
Concentration: 10 μg/mL
Incubation Time: 24 hours
Result: Resulted in 55.9% cells stalled in G0/G1 phase, 34.1% cells stalled in S phase and 10% cells stalled in G2/M phase.

Apoptosis Analysis[1]

Cell Line: Human A549 cells
Concentration: 10 μg/mL
Incubation Time: 24 hours
Result: Induced 1.1% cells apoptosis.
Molecular Weight

3963.21

Formula

C178H252F3
Unlabeled CAS

Sequence Shortening

{Glp}LGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF-NH2
SMILES

[{Glp}LGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF-NH2 (TFA salt)]
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Big Gastrin I (human) (TFA) Related Classifications

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Big Gastrin I (human) (TFA)Othersbig gastrin Igastrinpeptideinflammatory diseasescancer neurological diseasesInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Big Gastrin I (human) (TFA)
Cat. No.:
HY-P3446A
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.