2. Peptides
  3. Peptide and Derivatives
  4. Hormones and Neuropeptides
  5. Brain Natriuretic Peptide-45, rat TFA

Brain Natriuretic Peptide-45, rat TFA  (Synonyms: BNP-45, rat TFA)

Cat. No.: HY-P1573A
Handling Instructions

Molarity Calculator

Brain Natriuretic Peptide-45, rat TFA (BNP-45, rat TFA) is a circulating form of rat brain natriuretic peptide isolated from rat heart with potent hypotensive and natriuretic potency.

For research use only. We do not sell to patients.

Brain Natriuretic Peptide-45, rat TFA Chemical Structure

Brain Natriuretic Peptide-45, rat TFA Chemical Structure

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other Forms of Brain Natriuretic Peptide-45, rat TFA:

Brain Natriuretic Peptide-45, rat TFA Related Antibodies

Top Publications Citing Use of Products

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Brain Natriuretic Peptide-45, rat TFA (BNP-45, rat TFA) is a circulating form of rat brain natriuretic peptide isolated from rat heart with potent hypotensive and natriuretic potency[1].

In Vivo

Brain Natriuretic Peptide-45, rat (0.1, 0.2, 0.5, 1.0 and 2.0 nmol/kg, i.v.) shows potent natriuretic and hypotensive activities in anesthetized spontaneously hypertensive rats (SHR) and Wistar-Kyoto rats (WKY). Brain Natriuretic Peptide-45, rat with high concentration decreases blood pressure in SHR. But WKY is more susceptible than SHR to BNP-45 for diuresis, natriuresis and urinary cGMP excretion. In addition, high dose of Brain Natriuretic Peptide-45, rat cuases prolonged lowering of blood pressure and urinary cGMP excretion in WKY[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Molecular Weight

5040.67 (free acid)

Formula

C213H349N71O65S3.xC2HF3O2
Unlabeled CAS

Sequence

Ser-Gln-Asp-Ser-Ala-Phe-Arg-Ile-Gln-Glu-Arg-Leu-Arg-Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe(Disulfide bridge: Cys23-Cys39)
Sequence Shortening

SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF(Disulfide bridge: Cys23-Cys39)
SMILES

O=C(N[C@@H](CCC(N)=O)C(N[C@@H](CC(O)=O)C(N[C@@H](CO)C(N[C@@H](C)C(N[C@@H](CC1=CC=CC=C1)C(N[C@@H](CCCNC(N)=N)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CCC(N)=O)C(N[C@@H](CCC(O)=O)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CC(C)C)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CC(N)=O)C(N[C@@H](CO)C(N[C@@H](CCCCN)C(N[C@@H](CCSC)C(N[C@@H](C)C(N[C@@H](CC2=CNC=N2)C(N[C@@H](CO)C(N[C@@H](CO)C(N[C@@H](CO)C(N[C@@H](CSSC[C@@H](C(N[C@@H](CC(O)=O)C(NCC(N[C@@H](CC(C)C)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CC(C)C)C(N[C@@H](CC3=CC=CC=C3)C(O)=O)=O)=O)=O)=O)=O)=O)NC4=O)C(N[C@@H](CC5=CC=CC=C5)C(NCC(N[C@@H](CCC(N)=O)C(N[C@@H](CCCCN)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CC(O)=O)C(N[C@@H](CCCNC(N)=N)C(N[C@@H]([C@@H](C)CC)C(NCC(N[C@@H](C)C(N[C@@H](C(C)C)C(N[C@@H](CO)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CC(C)C)C(NC4)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)[C@H](CO)N.O=C(O)C(F)(F)F
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Brain Natriuretic Peptide-45, rat TFA Related Classifications

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Brain Natriuretic Peptide-45, ratBNP-45, ratOthersInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Brain Natriuretic Peptide-45, rat TFA
Cat. No.:
HY-P1573A
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.