1. GPCR/G Protein Neuronal Signaling
  2. CGRP Receptor
  3. Calcitonin (human)

Calcitonin (human) is a hypocalcemic hormone. Calcitonin can lower blood calcium levels and inhibit bone resorption. Calcitonin can be used in hypercalcemia or osteoporosis research.

For research use only. We do not sell to patients.

Calcitonin (human) Chemical Structure

Calcitonin (human) Chemical Structure

CAS No. : 21215-62-3

Size Price Stock Quantity
1 mg USD 160 In-stock
5 mg USD 460 In-stock
10 mg   Get quote  
50 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Calcitonin (human) is a hypocalcemic hormone. Calcitonin can lower blood calcium levels and inhibit bone resorption. Calcitonin can be used in hypercalcemia or osteoporosis research[1][2][3].

In Vitro

Calcitonin shows a potent inhibitory action on osteoclast mediated bone resorption[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

Calcitonin (oral gavage; 2 mg/kg; once daily; 9 w) can inhibit cartilage degradation and prevent cartilage erosion[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Female Sprague-Dawley rats[3]
Dosage: 2 mg/kg
Administration: Oral gavage; 2 mg/kg; once daily; 9 weeks
Result: Suppressed ovariectomy-induced cartilage degradation (P<0.001) compared with the carrier control.
Prevented cartilage erosion compared with treatment with the carrier alone (P<0.01), and the extent of erosions was comparable with that in sham-operated animals.
Molecular Weight

3417.87

Formula

C151H226N40O45S3

CAS No.
Unlabeled CAS

Appearance

Solid

Color

White to off-white

Sequence

Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 (Disulfide bridge:Cys1-Cys7)

Sequence Shortening

CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 (Disulfide bridge:Cys1-Cys7)

SMILES

O=C(NCC(N[C@@H](CC(N)=O)C(N[C@@H](CC(C)C)C(N[C@@H](CO)C(N[C@H]1[C@H](O)C)=O)=O)=O)=O)[C@H](CSSC[C@@H](C(N[C@@H](CCSC)C(N[C@@H](CC(C)C)C(NCC(N[C@@H]([C@H](O)C)C(N[C@@H](CC2=CC=C(C=C2)O)C(N[C@@H]([C@H](O)C)C(N[C@@H](CCC(N)=O)C(N[C@@H](CC(O)=O)C(N[C@@H](CC3=CC=CC=C3)C(N[C@@H](CC(N)=O)C(N[C@@H](CCCCN)C(N[C@@H](CC4=CC=CC=C4)C(N[C@@H](CC5=CNC=N5)C(N[C@@H]([C@H](O)C)C(N[C@@H](CC6=CC=CC=C6)C(N7[C@@H](CCC7)C(N[C@@H](CCC(N)=O)C(N[C@@H]([C@H](O)C)C(N[C@@H](C)C(N[C@@H]([C@@H](C)CC)C(NCC(N[C@@H](C(C)C)C(NCC(N[C@@H](C)C(N8[C@@H](CCC8)C(N)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)NC1=O)N

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility
In Vitro: 

DMSO : ≥ 50 mg/mL (14.63 mM; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

H2O : 2 mg/mL (0.59 mM; Need ultrasonic)

*"≥" means soluble, but saturation unknown.

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2926 mL 1.4629 mL 2.9258 mL
5 mM 0.0585 mL 0.2926 mL 0.5852 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
Purity & Documentation

Purity: 99.70%

References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
DMSO 1 mM 0.2926 mL 1.4629 mL 2.9258 mL 7.3145 mL
5 mM 0.0585 mL 0.2926 mL 0.5852 mL 1.4629 mL
10 mM 0.0293 mL 0.1463 mL 0.2926 mL 0.7314 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Calcitonin (human)
Cat. No.:
HY-P2273
Quantity:
MCE Japan Authorized Agent: