1. GPCR/G Protein
  2. GCGR
  3. Des His1, Glu8 Exendin-4

Des His1, Glu8 Exendin-4 is a potent glucagon-like peptide-1 receptor (GLP-1-R) antagonist. Des His1, Glu8 Exendin-4 improves glucose homeostasis by regulating both insulin secretion and glucose production. Des His1, Glu8 Exendin-4 can be used for the research of type 2 diabetic and gastrointestinal.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Des His1, Glu8 Exendin-4 Chemical Structure

Des His1, Glu8 Exendin-4 Chemical Structure

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Des His1, Glu8 Exendin-4 is a potent glucagon-like peptide-1 receptor (GLP-1-R) antagonist. Des His1, Glu8 Exendin-4 improves glucose homeostasis by regulating both insulin secretion and glucose production. Des His1, Glu8 Exendin-4 can be used for the research of type 2 diabetic and gastrointestinal[1].

In Vivo

Des His1, Glu8 Exendin-4 (dH-EX) (i3vt injection; 50 μg, 2 μL/15 s) improves glucose homeostasis by regulating both insulin secretion and glucose production[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Rat[1]
Dosage: 50 μg, 2 μl/15 s
Administration: i3vt injection
Result: Showed hyperglycemic for the first 45 min after the intraperitoneal glucose load.
Significantly increased insulin levels and insulin area under the curve (AUC) during the IVGTT.
Molecular Weight

4063.46

Formula

C179H277N47O59S

Unlabeled CAS

Sequence Shortening

GEGTFTSELSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Des His1, Glu8 Exendin-4 Related Classifications

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Des His1, Glu8 Exendin-4
Cat. No.:
HY-P3542
Quantity:
MCE Japan Authorized Agent: