1. MAPK/ERK Pathway Stem Cell/Wnt
  2. ERK
  3. Endothelin-1 (1-31) (Human) TFA

Endothelin-1 (1-31) (Human) TFA 

Cat. No.: HY-P4159A Purity: 99.07%
COA Handling Instructions

Endothelin-1 (1-31) (Human) TFA is a potent vasoconstrictor and hypertensive agent. Endothelin-1 (1-31) (Human) TFA is derived from the selective hydrolysis of big ET-1 by chymase.

For research use only. We do not sell to patients.

Endothelin-1 (1-31) (Human) TFA Chemical Structure

Endothelin-1 (1-31) (Human) TFA Chemical Structure

Size Price Stock Quantity
1 mg USD 230 In-stock
5 mg USD 700 In-stock
10 mg USD 1050 In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of Endothelin-1 (1-31) (Human) TFA:

Top Publications Citing Use of Products

1 Publications Citing Use of MCE Endothelin-1 (1-31) (Human) TFA

View All ERK Isoform Specific Products:

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Endothelin-1 (1-31) (Human) TFA is a potent vasoconstrictor and hypertensive agent. Endothelin-1 (1-31) (Human) TFA is derived from the selective hydrolysis of big ET-1 by chymase[1].

In Vitro

Endothelin-1 (1-31) (Human) (100 pM-100 nM; 24 h) TFA induces human mesangial cells proliferation[2].
Endothelin-1 (1-31) (Human) (100 nM; 0-10 min) TFA induces ERK activation in human mesangial cells[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Cell Proliferation Assay[2]

Cell Line: Human mesangial cells
Concentration: 100 pM-100 nM
Incubation Time: 24 h
Result: Caused an increase in [3H]-thymidine incorporation into the cells in a concentration-dependent manner.

Western Blot Analysis[2]

Cell Line: Human mesangial cells
Concentration: 100 nM
Incubation Time: 0, 5, 10, 15 and 30 min
Result: ERK activities rapidly increased 2.45-fold at 5 min and peaked at 10 min. The activities of both ERKs rapidly declined, returning to the baseline control value 30 min after stimulation.
In Vivo

ET-1 (1-31) (100 nM; single dose) TFA induces contraction in the mouse mesenteric artery. The contraction may be mediated by the ETA receptor and may be increased by aging. A clear difference exists between males and females in the present chronic diabetic condition[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: ICR mice, Streptozocin (HY-13753)-induced diabetic model[1]
Dosage: 100 nM
Administration: In the organ bath, single dose
Result: In the 1-week control (but not diabetic) group, induced contraction and the contractile response was significantly greater in female mice than in male mice, and there was no significant difference in either male or female mice between the age-matched controls and the diabetic mice. In the 8-weeks group, the contraction was or tended to be increased compared with the corresponding 1-week group in all mice. Although in male mice this contraction was not different between control and diabetic groups, it was significantly greater in diabetic female mice than in the control female mice and in female diabetic mice than in male diabetic mice. The contraction was inhibited by ETA receptor inhibitor.
Molecular Weight

3742.18

Formula

C164H237F3N38O49S5

Unlabeled CAS

Appearance

Solid

Color

White to off-white

Sequence

Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-His-Val-Val-Pro-Tyr (Disulfide bridge:Cys1-Cys15;Cys3-Cys11)

Sequence Shortening

CSCSSLMDKECVYFCHLDIIWVNTPEHVVPY (Disulfide bridge:Cys1-Cys15;Cys3-Cys11)

SMILES

[CSCSSLMDKECVYFCHLDIIWVNTPEHVVPY (Disulfide bridge:Cys1-Cys15;Cys3-Cys11) (TFA salt)]

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture and light, under nitrogen

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Endothelin-1 (1-31) (Human) TFA Related Classifications

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Endothelin-1 (1-31) (Human) TFA
Cat. No.:
HY-P4159A
Quantity:
MCE Japan Authorized Agent: