Glucagon-like peptide 1 (1-37), human TFA (Synonyms: HuGLP-1 TFA)

Name: Glucagon-like peptide 1 (1-37), human TFA
Brand: MedChemExpress
SKU: HY-P1145A
Rating: 4.5 (1 reviews)

Cat. No.: HY-P1145A Purity: 95.21%: FAQs
Data Sheet SDS COA Handling Instructions

Molarity Calculator

Glucagon-like peptide 1 (1-37), human (TFA) is a highly potent agonist of the GLP-1 receptor.

For research use only. We do not sell to patients.

Glucagon-like peptide 1 (1-37), human TFA Chemical Structure

Size	Price	Stock	Quantity
500 μg	USD 270	In-stock	Estimated Time of Arrival: December 31
1 mg	USD 440	In-stock	Estimated Time of Arrival: December 31
5 mg		Get quote
10 mg		Get quote

or Bulk Inquiry

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of Glucagon-like peptide 1 (1-37), human TFA:

Glucagon-like peptide 1 (1-37), human Get quote

Featured Recommendations

•Related Screening Libraries:

•Related Small Molecules:

•Related Proteins:

Biological Activity
Protocol
Purity & Documentation
References
Customer Review

Description

Glucagon-like peptide 1 (1-37), human (TFA) is a highly potent agonist of the GLP-1 receptor.

IC₅₀ & Target

GLP-1 receptor^[1].

In Vitro

Glucagon-like peptide-1 (GLP-1) is produced by the posttranslational processing of proglucagon and acts as a regulator of various homeostatic events. GLP-1(1-37) is more stable than GLP-1(7-37), with 94.7% of the initial amount of peptide left after a 4h exposure to mouse serum. GLP-1(1-37) is confirmed to be a highly potent agonist of the GLP-1 receptor (GLP-1R) by measuring the expression of the luciferase reporter gene expression in transiently transfected human embryonic kidney (HEK293) cells^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

GLP-1(1–37) decreases glycemic excursion in a dose-dependent. The administration of GLP-1(1–37) or GLP-1(7–37) markedly decrease blood glucose levels at 15 min and 30 min compared with the control group^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

4169.48 (free acid)

Formula

C₁₈₆H₂₇₅N₅₁O₅₉.xC₂HF₃O₂

Unlabeled CAS

Appearance

Solid

Color

White to off-white

Sequence

His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly

Sequence Shortening

HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG

SMILES

OC(C(F)(F)F)=O.O=C(N[C@@H](CC(O)=O)C(N[C@@H](CCC(O)=O)C(N[C@@H](CC1=CC=CC=C1)C(N[C@@H](CCC(O)=O)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CC2=CNC=N2)C(N[C@@H](C)C(N[C@@H](CCC(O)=O)C(NCC(N[C@@H]([C@H](O)C)C(N[C@@H](CC3=CC=CC=C3)C(N[C@@H]([C@H](O)C)C(N[C@@H](CO)C(N[C@@H](CC(O)=O)C(N[C@@H](C(C)C)C(N[C@@H](CO)C(N[C@@H](CO)C(N[C@@H](CC4=CC=C(C=C4)O)C(N[C@@H](CC(C)C)C(N[C@@H](CCC(O)=O)C(NCC(N[C@@H](CCC(N)=O)C(N[C@@H](C)C(N[C@@H](C)C(N[C@@H](CCCCN)C(N[C@@H](CCC(O)=O)C(N[C@@H](CC5=CC=CC=C5)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](C)C(N[C@@H](CC6=CNC7=CC=CC=C67)C(N[C@@H](CC(C)C)C(N[C@@H](C(C)C)C(N[C@@H](CCCCN)C(NCC(N[C@@H](CCCNC(N)=N)C(NCC(O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)[C@H](CC8=CNC=N8)N

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture and light

Powder	-80°C	2 years
	-20°C	1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

Solvent & Solubility

In Vitro:

DMSO : 1.8 mg/mL (Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

Molarity Calculator
Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

In Vivo Dissolution Calculator

Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.

Calculation results:

Working solution concentration: mg/mL

Purity & Documentation

Purity: 95.21%

Select Batch:

Data Sheet (268 KB) SDS (252 KB)

COA (241 KB) RP-HPLC (212 KB)

Handling Instructions (2659 KB)

References

[1]. Zhao L, et al. Glucagon-like peptide-1(1-37) can enhance blood glucose homeostasis in mice. Regul Pept. 2012 Oct 10;178(1-3):1-5. [Content Brief]

Cell Assay ^[1]	HEK293 cells (5×10⁴) are seeded in a 96-well plate and transiently cotransfected with the GLP-1R plasmid and the CRE-luciferase reporter plasmid. After a 48 h transfection, different concentrations of GLP-1(1–37) or GLP-1(7–37) (TFA) are added, and the cells are incubated for 5 h. The cells are harvested for a luciferase assay using a luciferase assay^[1]. MCE has not independently confirmed the accuracy of these methods. They are for reference only.
Animal Administration ^[1]	Mice^[1] The normal KM mice are fasted for 16 h before the administration (i.p.) of GLP-1 and glucose. GLP-1(1-37) (25 nmol/kg) with or without exendin(9-39) (250 nmol/kg) is given in combination with glucose (4 g/kg). GLP-1(7-37) (25 nmol/kg) with or without exendin(9-39) (250 nmol/kg) is also administrated in combination with glucose (4 g/kg). The control group is treated with saline (NaCl, 9 g/L) and glucose (4 g/kg). The IPGTT is carried out at 0, 15, 30 and 60 min after glucose and protein administration, and the blood glucose levels are measured as described above^[1]. MCE has not independently confirmed the accuracy of these methods. They are for reference only.
References	[1]. Zhao L, et al. Glucagon-like peptide-1(1-37) can enhance blood glucose homeostasis in mice. Regul Pept. 2012 Oct 10;178(1-3):1-5. [Content Brief]

Glucagon-like peptide 1 (1-37), human TFA Related Classifications

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Glucagon-like peptide 1 (1-37), humanHuGLP-1HuGLP1HuGLP 1GCGRGlucagon ReceptorInhibitorinhibitorinhibit

Your Recently Viewed Products:

Product Name

Salutation

Applicant Name *

Email Address *

Phone Number *

Organization Name *

Department *

Requested quantity *

Country or Region *

Remarks

Product Name			Lot #
Applicant Name *			Email Address *
Phone Number			Department *
Organization Name *			Country or Region *
Remarks

Name
Email *

	Sorry, but the email address you supplied was invalid.

Glucagon-like peptide 1 (1-37), human TFA (Synonyms: HuGLP-1 TFA)

Customer Review

Other Forms of Glucagon-like peptide 1 (1-37), human TFA:

Glucagon-like peptide 1 (1-37), human TFA Related Antibodies

Featured Recommendations

•Related Screening Libraries:

•Related Small Molecules:

•Related Proteins:

Biological Activity

Protocol

Purity & Documentation

References

Customer Review

Glucagon-like peptide 1 (1-37), human TFA Related Antibodies

Molarity Calculator

Dilution Calculator

Glucagon-like peptide 1 (1-37), human TFA Related Classifications

Keywords:

Your Recently Viewed Products:

Customer Review

Request for HNMR Report

Request for HNMR Report