Hainantoxin-IV  (Synonyms: HNTX-IV)

Hainantoxin-IV is a specific antagonist of Sodium Channel, targeting to tetrodotoxin-sensitive (TTX-S) voltage-gated sodium channels. His28 and Lys32 are the key resiudes of Hainantoxin-IV for binding with target, while Hainantoxin-IV adopts an inhibitor cystine knot motif^[1].

3987.53

C₁₆₆H₂₅₇N₅₃O₅₀S₆

651782-02-4

Glu-Cys-Leu-Gly-Phe-Gly-Lys-Gly-Cys-Asn-Pro-Ser-Asn-Asp-Gln-Cys-Cys-Lys-Ser-Ser-Asn-Leu-Val-Cys-Ser-Arg-Lys-His-Arg-Trp-Cys-Lys-Tyr-Glu-Ile-NH2 (Disulfide bridge: Cys2-Cys17; Cys9-Cys24; Cys16-Cys31)

ECLGFGKGCNPSNDQCCKSSNLVCSRKHRWCKYEI-NH2 (Disulfide bridge: Cys2-Cys17; Cys9-Cys24; Cys16-Cys31)

O=C(N[C@@H](CSSC[C@@H](C(N[C@@H](CCCCN)C(N[C@@H](CO)C(N[C@@H](CO)C(N[C@@H](CC(N)=O)C(N[C@@H](CC(C)C)C(N[C@H]1C(C)C)=O)=O)=O)=O)=O)=O)NC2=O)C(N[C@@H](CC(C)C)C(NCC(N[C@@H](CC3=CC=CC=C3)C(NCC(N[C@@H](CCCCN)C(NCC(N[C@@H](CSSC[C@@H](C(N[C@@H](CO)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCCN)C(N[C@@H](CC4=CNC=N4)C(N[C@@H](CCCNC(N)=N)C(N[C@H]5CC6=CNC7=CC=CC=C67)=O)=O)=O)=O)=O)=O)NC1=O)C(N[C@@H](CC(N)=O)C(N8[C@@H](CCC8)C(N[C@@H](CO)C(N[C@@H](CC(N)=O)C(N[C@@H](CC(O)=O)C(N[C@@H](CCC(N)=O)C(N[C@H]2CSSC[C@@H](C(N[C@@H](CCCCN)C(N[C@@H](CC9=CC=C(C=C9)O)C(N[C@@H](CCC(O)=O)C(N[C@@H]([C@@H](C)CC)C(N)=O)=O)=O)=O)=O)NC5=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)[C@H](CCC(O)=O)N

Room temperature in continental US; may vary elsewhere.

Please store the product under the recommended conditions in the Certificate of Analysis.

• [1]. Liu Y, et al. A positively charged surface patch is important for hainantoxin-IV binding to voltage-gated sodium channels. J Pept Sci. 2012 Oct;18(10):643-9.  [Content Brief]