1. Protein Tyrosine Kinase/RTK
  2. Insulin Receptor
  3. Insulin(cattle/bovine), purity>95%

Insulin(cattle/bovine), purity>95% 

Cat. No.: HY-P1156A Purity: 99.94%
COA Handling Instructions

Insulin cattle is a two-chain polypeptide hormone produced in vivo in the pancreatic β cells. Insulin cattle has often been used as growth supplement in culturing cells.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Insulin(cattle/bovine), purity>95% Chemical Structure

Insulin(cattle/bovine), purity>95% Chemical Structure

CAS No. : 11070-73-8

Size Price Stock Quantity
1 mg USD 42 In-stock
5 mg USD 85 Get quote
10 mg USD 135 Get quote
25 mg USD 270 Get quote
50 mg USD 430 Get quote
100 mg USD 690 Get quote
200 mg   Get quote  
500 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 7 publication(s) in Google Scholar

Other Forms of Insulin(cattle/bovine), purity>95%:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Insulin cattle is a two-chain polypeptide hormone produced in vivo in the pancreatic β cells. Insulin cattle has often been used as growth supplement in culturing cells.

In Vitro

Insulin cattle is the two-chain polypeptide hormone produced by the β-cells of pancreatic islets. The α and β chains are joined by two interchain disulfide bonds. The α chain contains an intrachain disulfide bond. Insulin regulates glucose uptake into muscle and fat cells by recruiting membrane glucose transporter Glut-4 to cell surface. Insulin cattle has often been used as growth supplement in culturing cells at the concentration ranging from 1 to 10 μg/mL of medium[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

5733.49

Formula

C254H377N65O75S6

CAS No.
Unlabeled Cas

Appearance

Solid

Color

Off-white to light yellow

Sequence

Phe-Val-Asn-Gln-His-Leu-Cys-Gly-Ser-His-Leu-Val-Glu-Ala-Leu-Tyr-Leu-Val-Cys-Gly-Glu-Arg-Gly-Phe-Phe-Tyr-Thr-Pro-Lys-Ala. Gly-Ile-Val-Glu-Gln-Cys-Cys-Ala-Ser-Val-Cys-Ser-Leu-Tyr-Gln-Leu-Glu-Asn-Tyr-Cys-Asn (Disulfide bridge: Cys7-Cys7', Cys19-Cys20', Cys6'-Cys11')

Sequence Shortening

FVNQHLCGSHLVEALYLVCGERGFFYTPKA. GIVEQCCASVCSLYQLENYCN (Disulfide bridge: Cys7-Cys7', Cys19-Cys20', Cys6'-Cys11')

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Insulin(cattle/bovine), purity>95% Related Classifications

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Insulin(cattle/bovine), purity>95%
Cat. No.:
HY-P1156A
Quantity:
MCE Japan Authorized Agent: