1. Peptides
  2. NEP(1-40) TFA

NEP(1-40) TFA is a Nogo-66 receptor (NgR) antagonist peptide, reversing the injury-induced shift in distribution of microglia morphologies by limiting myelin-based inhibition.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

NEP(1-40) TFA Chemical Structure

NEP(1-40) TFA Chemical Structure

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other In-stock Forms of NEP(1-40) TFA:

Other Forms of NEP(1-40) TFA:

Top Publications Citing Use of Products

1 Publications Citing Use of MCE NEP(1-40) TFA

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

NEP(1-40) TFA is a Nogo-66 receptor (NgR) antagonist peptide, reversing the injury-induced shift in distribution of microglia morphologies by limiting myelin-based inhibition[1].

In Vivo

NEP(1-40) (89 μg/kg, ip, 15 min and 19 h post-injury) administration further shifts distributions of microglia away from an injury-induced activated morphology towards greater proportions of rod and macrophage-like morphologies[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: 74 male Sprague-Dawley rats (328-377 g)[1].
Dosage: 89 μg/kg (97.5% PBS and 2.5% DMSO).
Administration: IP, 15 min and 19 h post-injury.
Result: Reduced NgR function immediately post-injury.
Increased number of amoeboid microglia/macrophages at 2 days post-injury
Molecular Weight

4739.13

Formula

C208H325F3N56O67

Unlabeled CAS

Sequence

Arg-Ile-Tyr-Lys-Gly-Val-Ile-Gln-Ala-Ile-Gln-Lys-Ser-Asp-Glu-Gly-His-Pro-Phe-Arg-Ala-Tyr-Leu-Glu-Ser-Glu-Val-Ala-Ile-Ser-Glu-Glu-Leu-Val-Gln-Lys-Tyr-Ser-Asn-Ser-NH2

Sequence Shortening

RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

NEP(1-40) TFA Related Classifications

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NEP(1-40) TFA
Cat. No.:
HY-P1242A
Quantity:
MCE Japan Authorized Agent: