1. Peptides
  2. Peptide and Derivatives
  3. Peptides for Drug Delivery
  4. Responsive Peptides
  5. pH-Low Insertion Peptide

pH-Low Insertion Peptide  (Synonyms: pHLIP)

Cat. No.: HY-P4116 Purity: 96.37%
COA Handling Instructions

pH-Low Insertion Peptide (pHLIP) used as a specific ligand to target the tumor acidic microenvironment for tumors at early and metastatic stages.

For research use only. We do not sell to patients.

pH-Low Insertion Peptide Chemical Structure

pH-Low Insertion Peptide Chemical Structure

CAS No. : 2293160-09-3

Size Price Stock Quantity
1 mg USD 150 In-stock
5 mg USD 320 In-stock
10 mg USD 520 In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

pH-Low Insertion Peptide (pHLIP) used as a specific ligand to target the tumor acidic microenvironment for tumors at early and metastatic stages[1].

Molecular Weight

4054.56

Formula

C189H28N4O55S

CAS No.
Appearance

Solid

Color

White to off-white

Sequence

Ala-Cys-Glu-Gln-Asn-Pro-Ile-Tyr-Trp-Ala-Arg-Tyr-Ala-Asp-Trp-Leu-Phe-Thr-Thr-Pro-Leu-Leu-Leu-Leu-Asp-Leu-Ala-Leu-Leu-Val-Asp-Ala-Asp-Glu-Thr

Sequence Shortening

ACEQNPIYWARYADWLFTTPLLLLDLALLVDADET

SMILES

[Ala-Cys-Glu-Gln-Asn-Pro-Ile-Tyr-Trp-Ala-Arg-Tyr-Ala-Asp-Trp-Leu-Phe-Thr-Thr-Pro-Leu-Leu-Leu-Leu-Asp-Leu-Ala-Leu-Leu-Val-Asp-Ala-Asp-Glu-Thr]

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture and light

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

Solvent & Solubility
In Vitro: 

DMSO : 100 mg/mL (24.66 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2466 mL 1.2332 mL 2.4664 mL
5 mM 0.0493 mL 0.2466 mL 0.4933 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
Purity & Documentation
References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
DMSO 1 mM 0.2466 mL 1.2332 mL 2.4664 mL 6.1659 mL
5 mM 0.0493 mL 0.2466 mL 0.4933 mL 1.2332 mL
10 mM 0.0247 mL 0.1233 mL 0.2466 mL 0.6166 mL
15 mM 0.0164 mL 0.0822 mL 0.1644 mL 0.4111 mL
20 mM 0.0123 mL 0.0617 mL 0.1233 mL 0.3083 mL
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

pH-Low Insertion Peptide Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
pH-Low Insertion Peptide
Cat. No.:
HY-P4116
Quantity:
MCE Japan Authorized Agent: