Protein Kinase C (530-558)  (Synonyms: PKC fragment (530-558))

Protein Kinase C (530-558), a peptide fragment of protein kinase C (PKC), is a potent PKC activator. Protein Kinase C (530-558) significantly inhibits osteoclastic bone resorption^[1].

Protein Kinase C (530-558) (1 nM-1 μM, 24 h) causes a dose-responsive inhibition of bone resorption, which is accompanied by a rapid and distinctive change in osteoclast morphology^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

3354.67

C₁₄₈H₂₂₁N₃₅O₅₀S₂

122613-29-0

LLYEMLAGQAPFEGEDEDELFQSIMEHNV-NH2

CC(C)[C@@H](C(N)=O)NC([C@H](CC(N)=O)NC([C@H](CC1=CN=CN1)NC([C@H](CCC(O)=O)NC([C@H](CCSC)NC([C@H]([C@@H](C)CC)NC([C@H](CO)NC([C@H](CCC(N)=O)NC([C@H](CC2=CC=CC=C2)NC([C@H](CC(C)C)NC([C@H](CCC(O)=O)NC([C@H](CC(O)=O)NC([C@H](CCC(O)=O)NC([C@H](CC(O)=O)NC([C@H](CCC(O)=O)NC(CNC([C@H](CCC(O)=O)NC([C@H](CC3=CC=CC=C3)NC([C@H]4N(CCC4)C([C@H](C)NC([C@H](CCC(N)=O)NC(CNC([C@H](C)NC([C@H](CC(C)C)NC([C@H](CCSC)NC([C@H](CCC(O)=O)NC([C@@H](NC([C@H](CC(C)C)NC([C@@H](N)CC(C)C)=O)=O)CC5=CC=C(C=C5)O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O

Room temperature in continental US; may vary elsewhere.

Please store the product under the recommended conditions in the Certificate of Analysis.

• [1]. Moonga BS, et al. Effects of peptide fragments of protein kinase C on isolated rat osteoclasts. Exp Physiol. 1998 Nov;83(6):717-25.  [Content Brief]