1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. AlkB Protein, E.coli (Myc, His-SUMO)

AlkB Protein, E.coli (Myc, His-SUMO)

Cat. No.: HY-P71479
COA Handling Instructions

AlkB Protein, E.coli (Myc, His-SUMO) is a protein found in E. coli, plays a major role in oxidative dealkylation processes.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $75 In-stock
10 μg $125 In-stock
50 μg $350 In-stock
100 μg $560 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

AlkB Protein, E.coli (Myc, His-SUMO) is a protein found in E. coli, plays a major role in oxidative dealkylation processes.

Background

Iron-dependent dioxygenases of the AlkB protein family found in most organisms throughout the tree of life play a major role in oxidative dealkylation processes. In higher eukaryotes including yeast, plants and mammals, members of the AlkB family play pivotal roles. In humans, this family draws particular interest because of its involvement in DNA repair and progression of cancer, as they are frequently overexpressed in tumors and counteract the effects of alkylating drugs such as temozolamide used in chemotherapy. The alkylation-sensitive phenotype of E. coli alkB mutants marks the alkB pathway as an extremely effective defense mechanism against the cytotoxic effects of the SN2, but not the SN1, alkylating agents[1][2].

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

E.coli

Source

E. coli

Tag

N-His;C-Myc;N-SUMO

Accession

P05050 (M1-E216)

Gene ID

946708  [NCBI]

Molecular Construction
N-term
10*His-SUMO
AlkB (M1-E216)
Accession # P05050
Myc
C-term
Synonyms
alkB; aidD; b2212; JW2200Alpha-ketoglutarate-dependent dioxygenase AlkB; EC 1.14.11.33; Alkylated DNA repair protein AlkB; DNA oxidative demethylase AlkB
AA Sequence

MLDLFADAEPWQEPLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLSLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGKKE

Molecular Weight

Approximately 44.1 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against solution in Tris-based buffer, 50% glycerol.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

AlkB Protein, E.coli (Myc, His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
AlkB Protein, E.coli (Myc, His-SUMO)
Cat. No.:
HY-P71479
Quantity:
MCE Japan Authorized Agent: