1. Recombinant Proteins
  2. Others Animal-free Recombinant Proteins
  3. Animal-Free Annexin A5/ANXA5 Protein, Human (His)

Animal-Free Annexin A5/ANXA5 Protein, Human (His)

Cat. No.: HY-P700015AF
COA Handling Instructions

Annexin A5 (ANXA5) protein acts as an anticoagulant, indirectly inhibiting the thromboplastin-specific complex in the coagulation cascade. ANXA5 exists as a monomer and its role is not limited to coagulation regulation, but also has binding interactions involving ATRX and EIF5B, suggesting its involvement in a variety of cells. Animal-Free Annexin A5/ANXA5 Protein, Human (His) is the recombinant human-derived animal-FreeAnnexin A5/ANXA5 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free Annexin A5/ANXA5 Protein, Human (His) is 320 a.a., with molecular weight of ~36.75 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $70 In-stock
10 μg $197 In-stock
50 μg $550 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Annexin A5 (ANXA5) protein acts as an anticoagulant, indirectly inhibiting the thromboplastin-specific complex in the coagulation cascade. ANXA5 exists as a monomer and its role is not limited to coagulation regulation, but also has binding interactions involving ATRX and EIF5B, suggesting its involvement in a variety of cells. Animal-Free Annexin A5/ANXA5 Protein, Human (His) is the recombinant human-derived animal-FreeAnnexin A5/ANXA5 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free Annexin A5/ANXA5 Protein, Human (His) is 320 a.a., with molecular weight of ~36.75 kDa.

Background

Annexin A5 (ANXA5) protein functions as an anticoagulant, serving as an indirect inhibitor of the thromboplastin-specific complex crucial in the blood coagulation cascade. Structurally, ANXA5 exists as a monomer, and its role extends beyond coagulation regulation. It exhibits binding interactions with ATRX and EIF5B, suggesting involvement in diverse cellular processes. Notably, ANXA5 interacts with the hepatitis B virus (HBV), indicating a potential role in viral interactions. The multifaceted attributes of ANXA5 underscore its significance in cellular regulation, offering potential insights into both hemostasis and its involvement in interactions with viral pathogens such as HBV.

Species

Human

Source

E. coli

Tag

C-His

Accession

P08758 (M1-D320)

Gene ID

308  [NCBI]

Molecular Construction
N-term
ANXA5 (M1-D320)
Accession # P08758
His
C-term
Synonyms
ANXA5; ANX5; ENX2; HEL-S-7; PP4; RPRGL3
AA Sequence

MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD

Molecular Weight

Approximately 36.75 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free Annexin A5/ANXA5 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free Annexin A5/ANXA5 Protein, Human (His)
Cat. No.:
HY-P700015AF
Quantity:
MCE Japan Authorized Agent: