1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Neurotrophic Factors
  4. Neurotrophins/NGF
  5. Nerve Growth Factor-β (Beta-NGF)
  6. Animal-Free Beta-NGF Protein, Mouse (His)

Animal-Free Beta-NGF Protein, Mouse (His)

Cat. No.: HY-P700162AF
COA Handling Instructions

Nerve Growth Factor-β (Beta-NGF; NGF) is a neurotrophic factor that regulates neuronal survival and differentiation. NGF is also a seminal plasma protein involved in ovulation and luteinizing. NGF has potential functions in the female reproductive system to help overcome the current problem of early embryo loss. Animal-Free Beta-NGF Protein, Mouse (His) is produced by E.coli (S122-G241), with C-terminal His-tag.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
2 μg $40 In-stock
10 μg $112 In-stock
50 μg $315 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Nerve Growth Factor-β (Beta-NGF; NGF) is a neurotrophic factor that regulates neuronal survival and differentiation. NGF is also a seminal plasma protein involved in ovulation and luteinizing. NGF has potential functions in the female reproductive system to help overcome the current problem of early embryo loss[1][2][3]. Animal-Free Beta-NGF Protein, Mouse (His) is produced by E.coli (S122-G241), with C-terminal His-tag.

Background

Nerve Growth Factor-β (Beta-NGF; NGF) is a basic protein of 118 amino acids which acts are a trophic factor for sensory and sympathetic neurons of the peripheral nervous system, and on cholinergic neurons of the anterior basal cerebrum[1]. NGF involves in the regulation of neuronal survival and differentiation. Elevated levels of NGF are associated with the risk of post-traumatic stress disorder (PTSD). The trauma response leads to methylation of DNA nucleotides responsible for NGF expression. NGF levels have shown increased sympathetic fiber density proportional to NGF messenger RNA (mRNA) levels. NGF is also a seminal plasma protein commonly found in mammals. For example, NGF acts as an ovulation stimulating factor in camels and has been shown to have luteinizing effects in bulls. NGF has a potential function in the female reproductive system. For example, NGF plays an important role in ovulation induction, LH release, ovulation, luteal development, progesterone (P4) production, vascularization of luteal body, and gonadotropin response. Application of NGF to cattle enhances steroid production, luteal formation and function by increasing LH release, and leads to increased mRNA expression of markers of pregnancy and development downstream. In addition, the potential luteinizing effect of NGF could help overcome the current problem of early embryo loss[2][3]. The similarity between human and bovine NGF protein sequence was 90.87%. Meanwhile, the similarity rate of human NGF with rat and mouse was 85.89% and 85.06%, respectively.

In Vitro

NGF (mouse; 4 ng/mL; 24 h) IL-6 production is induced and ALP activity and collagen biosynthesis are enhanced without affecting cell proliferation in osteoblast MC3T3-E1[4].

Biological Activity

Measure by its ability to induce TF-1 cells proliferation. The ED50 for this effect is <1 ng/mL. The specific activity of recombinant mouse beta-NGF is >1 x 106 IU/mg.

Species

Mouse

Source

E. coli

Tag

C-His

Accession

P01139 (S122-G241)

Gene ID

18049  [NCBI]

Molecular Construction
N-term
Beta-NGF (S122-G241)
Accession # P01139
His
C-term
Synonyms
beta-NGF; beta-Nerve Growth Factor; NGF; NGFB
AA Sequence

MSSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG

Molecular Weight

Approximately 14.41 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 4.5, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free Beta-NGF Protein, Mouse (His)
Cat. No.:
HY-P700162AF
Quantity:
MCE Japan Authorized Agent: