1. Recombinant Proteins
  2. Immune Checkpoint Proteins CAR-T Related Proteins CD Antigens Animal-free Recombinant Proteins
  3. Stimulatory Immune Checkpoint Molecules NK Cell CD Proteins Macrophage CD Proteins
  4. CD70
  5. Animal-Free CD70 Protein, Mouse (His)

Animal-Free CD70 Protein, Mouse (His)

Cat. No.: HY-P72741AF
COA Handling Instructions

The CD70 protein is an important member of the tumor necrosis factor family and plays a crucial role in immune regulation and cellular responses. Its study enhances our understanding of immune regulation, providing potential applications for immunoassays and therapeutics. Animal-Free CD70 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeCD70 protein, expressed by E. coli , with N-His, N-His labeled tag. The total length of Animal-Free CD70 Protein, Mouse (His) is 149 a.a., with molecular weight of ~17.25 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $42 In-stock
10 μg $116 In-stock
50 μg $324 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CD70 protein is an important member of the tumor necrosis factor family and plays a crucial role in immune regulation and cellular responses. Its study enhances our understanding of immune regulation, providing potential applications for immunoassays and therapeutics. Animal-Free CD70 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeCD70 protein, expressed by E. coli , with N-His, N-His labeled tag. The total length of Animal-Free CD70 Protein, Mouse (His) is 149 a.a., with molecular weight of ~17.25 kDa.

Background

The CD70 Protein is a notable member of the tumor necrosis factor family, highlighting its pivotal role in immune regulation and cellular responses. As part of this family, CD70 likely shares conserved structural and functional features with related proteins, emphasizing its involvement in signaling pathways associated with immune modulation. The classification within the tumor necrosis factor family underscores its specific designation within the broader context of cytokines, providing insights into its unique contributions to T cell activation and co-stimulation. The study of CD70 contributes to our understanding of its role in immune homeostasis, offering potential applications in various immunological assays and therapeutic developments without animal-derived components. Further exploration of CD70's role holds promise for enhancing our knowledge of its contributions to both normal immune function and pathological conditions.

Biological Activity

Measure by its ability to induce proliferation in mouse T cells in the presence of the anti-CD3 antibody. The ED50 for this effect is <4.5 μg/mL.

Species

Mouse

Source

E. coli

Tag

N-His;N-His

Accession

Q05A52 (Q47-P195)

Gene ID

21948  [NCBI]

Molecular Construction
N-term
His
CD70 (Q47-P195)
Accession # Q05A52
C-term
Synonyms
soluble CD27 Ligand; sCD27 Ligand; TNFSF7; CD70; Tnfs; Tnlg8a
AA Sequence

QQQRLLEHPEPHTAELQLNLTVPRKDPTLRWGAGPALGRSFTHGPELEEGHLRIHQDGLYRLHIQVTLANCSSPGSTLQHRATLAVGICSPAAHGISLLRGRFGQDCTVALQRLTYLVHGDVLCTNLTLPLLPSRNADETFFGVQWICP

Molecular Weight

Approximately 17.25 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free CD70 Protein, Mouse (His)
Cat. No.:
HY-P72741AF
Quantity:
MCE Japan Authorized Agent: