1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Neurotrophic Factors
  4. CDNF/MANF family
  5. CDNF
  6. Animal-Free CDNF Protein, Mouse (His)

Animal-Free CDNF Protein, Mouse (His)

Cat. No.: HY-P700166AF
COA Handling Instructions

CDNF (cerebral dopamine neurotrophic factor) emerges as a key trophic factor for dopamine neurons that counteracts 6-hydroxydopamine (6-OHDA)-induced degeneration. Notably, it can restore dopaminergic function and prevent nigral neuronal degeneration after 6-OHDA injury. Animal-Free CDNF Protein, Mouse (His) is the recombinant mouse-derived animal-FreeCDNF protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free CDNF Protein, Mouse (His) is 163 a.a., with molecular weight of ~19.47 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $41 In-stock
10 μg $113 In-stock
50 μg $316 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CDNF (cerebral dopamine neurotrophic factor) emerges as a key trophic factor for dopamine neurons that counteracts 6-hydroxydopamine (6-OHDA)-induced degeneration. Notably, it can restore dopaminergic function and prevent nigral neuronal degeneration after 6-OHDA injury. Animal-Free CDNF Protein, Mouse (His) is the recombinant mouse-derived animal-FreeCDNF protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free CDNF Protein, Mouse (His) is 163 a.a., with molecular weight of ~19.47 kDa.

Background

CDNF (Cerebral Dopamine Neurotrophic Factor) emerges as a crucial trophic factor for dopamine neurons, exhibiting the ability to counteract the degeneration induced by 6-hydroxydopamine (6-OHDA) in dopaminergic neurons. Particularly notable is its capacity to restore dopaminergic function and shield against the degeneration of neurons in the substantia nigra when administered subsequent to 6-OHDA-induced lesions. This underscores the potential therapeutic relevance of CDNF in mitigating the detrimental effects of neurodegeneration in the context of dopaminergic neurons, offering promise for interventions aimed at preserving and restoring neural function.

Species

Mouse

Source

E. coli

Tag

C-His

Accession

Q8CC36 (Q25-L187)

Gene ID

227526  [NCBI]

Molecular Construction
N-term
CDNF (Q25-L187)
Accession # Q8CC36
His
C-term
Synonyms
Cerebral dopamine neurotrophic factor; CDNF; ARMETL1
AA Sequence

MQGLEAGVGPRADCEVCKEFLDRFYNSLLSRGIDFSADTIEKELLNFCSDAKGKENRLCYYLGATTDAATKILGEVTRPMSVHIPAVKICEKLKKMDSQICELKYGKKLDLASVDLWKMRVAELKQILQRWGEECRACAEKSDYVNLIRELAPKYVEIYPQTEL

Molecular Weight

Approximately 19.47 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free CDNF Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free CDNF Protein, Mouse (His)
Cat. No.:
HY-P700166AF
Quantity:
MCE Japan Authorized Agent: