1. Recombinant Proteins
  2. CAR-T Related Proteins CD Antigens Animal-free Recombinant Proteins
  3. Epithelial Cell Adhesion Molecule (EpCAM) Stem Cell CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins
  4. CD326/EpCAM
  5. Animal-Free EpCAM/TROP1 Protein, Human (His)

Animal-Free EpCAM/TROP1 Protein, Human (His)

Cat. No.: HY-P700037AF
COA Handling Instructions

The EpCAM/TROP1 protein serves as an important homogeneous interacting molecule that promotes direct contact between intestinal epithelial cells (IEC) and intraepithelial lymphocytes (IEL) in the mucosal epithelium. This feature helps establish an immune barrier against mucosal infections. Animal-Free EpCAM/TROP1 Protein, Human (His) is the recombinant human-derived animal-FreeEpCAM/TROP1 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free EpCAM/TROP1 Protein, Human (His) is 242 a.a., with molecular weight of ~28.36 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $38 In-stock
10 μg $107 In-stock
50 μg $300 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The EpCAM/TROP1 protein serves as an important homogeneous interacting molecule that promotes direct contact between intestinal epithelial cells (IEC) and intraepithelial lymphocytes (IEL) in the mucosal epithelium. This feature helps establish an immune barrier against mucosal infections. Animal-Free EpCAM/TROP1 Protein, Human (His) is the recombinant human-derived animal-FreeEpCAM/TROP1 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free EpCAM/TROP1 Protein, Human (His) is 242 a.a., with molecular weight of ~28.36 kDa.

Background

The EpCAM/TROP1 Protein emerges as a pivotal entity, potentially functioning as a physical homophilic interaction molecule that fosters direct contact between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium, thereby contributing to the establishment of an immunological barrier as the primary defense against mucosal infections. Beyond its role in mucosal immunity, this protein plays a significant part in the proliferation and differentiation of embryonic stem cells. It further exhibits regulatory influence by up-regulating the expression of FABP5, MYC, and cyclins A and E, implicating EpCAM/TROP1 in the modulation of key cellular processes. Its monomeric nature and interaction with phosphorylated CLDN7 underscore the intricate molecular interactions involved, providing insights into the diverse functions of this protein in cellular physiology.

Biological Activity

Measure by the ability of the immobilized protein to support the adhesion of the 3T3 cells. The ED50 for this effect is 0.2-1.7 ng/mL.

Species

Human

Source

E. coli

Tag

C-His

Accession

P16422 (Q24-K265)

Gene ID
Molecular Construction
N-term
EPCAM (Q24-K265)
Accession # P16422
His
C-term
Synonyms
Epithelial cell adhesion molecule; Ep-CAM; EGP; KSA; CD326; TROP1
AA Sequence

MQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK

Molecular Weight

Approximately 28.36 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free EpCAM/TROP1 Protein, Human (His)
Cat. No.:
HY-P700037AF
Quantity:
MCE Japan Authorized Agent: