1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens Animal-free Recombinant Proteins
  3. TNF Superfamily T Cell CD Proteins NK Cell CD Proteins Epithelial cell CD Proteins Endothelial cell CD Proteins
  4. TNF Superfamily Ligands CD178/FasL
  5. Fas Ligand (FasL)
  6. Animal-Free FasL Protein, Human (His)

Animal-Free FasL Protein, Human (His)

Cat. No.: HY-P700052AF
COA Handling Instructions

Fas Ligand (CD178; APTL) is a ligand to TNFRSF6/FAS/CD95, transduces the apoptotic signal to regulate cytotoxic T-cell-mediated apoptosis, natural killer cell-mediated apoptosis and in T-cell development. Human Fas Ligand exhibits 4 isoforms, the soluble form (130-281 a.a.) of which plays an important role in the activation-induced cell death (AICD) of T lymphocytes Jurkat cells. However the membrane-bound isoform could be responsible for its inflammatory activity. Animal-Free FasL Protein, Human (His) has a total length of 152 amino acids (Q130-L281), is expressed in E. coli with N-terminal His-tag.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
2 μg $50 In-stock
10 μg $145 In-stock
50 μg $400 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Fas Ligand (CD178; APTL) is a ligand to TNFRSF6/FAS/CD95, transduces the apoptotic signal to regulate cytotoxic T-cell-mediated apoptosis, natural killer cell-mediated apoptosis and in T-cell development[1]. Human Fas Ligand exhibits 4 isoforms, the soluble form (130-281 a.a.) of which plays an important role in the activation-induced cell death (AICD) of T lymphocytes Jurkat cells[3]. However the membrane-bound isoform could be responsible for its inflammatory activity[4]. Animal-Free FasL Protein, Human (His) has a total length of 152 amino acids (Q130-L281), is expressed in E. coli with N-terminal His-tag.

Background

Fas Ligand (FasL; FASLG; CD95L), is a ligand for TNFRSF6/FAS belonging to the tumor necrosis factor (TNF). FasL is a type II transmembrane protein, riggering apoptosis of lymphocytes[1].
FasL is expressed on a variety of cell types, including T cells, natural killer (NK) cells, monocytes, neutrophils, breast epithelial cells, and vascular endothelial cells[2].
FasL exerts different biological activity by cleaved into 4 isoforms including membrane form, soluble form, ADAM10-processed FasL form (APL) and SPPL2A-processed FasL form (SPA). Among them, the membrane-bound form and a soluble form generated by proteolytic action of matrix metalloproteinases (MMP)[2].
FasL or soluble FasL binding to Fas results in receptor aggregation and in the interaction of a protein called Fas-associated death domain with the Fas cytoplasmic tail. The interaction triggers a cascade of intracellular events, including the activation of the IL-1-converting enzyme-like cysteine protease (caspase 8), that ultimately leads to nucleoprotein cleavage, DNA fragmentation, and cell apoptosis[5].
The loss of function due to mutations in murine FasL, murine Fas, human Fas, or human FasL leads to lymphoproliferation, lymphadenopathy, and autoimmune diseases[1][3].
Meanwhile, defective activation-induced cell death (AICD) results in spontaneous mutation of Fas and FasL genes in mice with lupus-like autoimmune disease[3].
Human Fas Ligand also involves in Jurkat cell apoptosis and binds TNFRSF6B/DcR3 to bolck apoptosis, which is a decoy receptor of apoptosis termination[2].
FasL is widely found in different animals, while the sequence in Human is different from Rat and Mouse with similarity of 77.26% and 78.06%, respectively.

In Vitro

Human soluble FasL (4 units/mL; 18 hr) induces neutrophil infiltration[4].
Human membrane-bound FasL (4 units/mL; 18 hr) is found to induce IL-1β release in plastic adherent macrophages separated from 4-day PEC instead of recombinant mouse soluble FasL (WX1)[4].
Soluble FasL (.1-1 nM) of human induces chemotaxis of mouse neutrophils in vitro at concentrations incapable of inducing cell apoptosis.[6].

In Vivo

Purified human soluble FasL (-1 ng; i.p.; single dose) does not show neutrophil chemotactic activity in vivo in ddY mice[4].
Expressing membrane-bound FasL (FFL, FDC2) but not soluble FasL (FFS) rejects tumor cells quickly than the control in wild-type mice[4].

Biological Activity

Measure by its ability to induce apoptosis in Jurkat cells. The ED50 for this effect is <1 ng/mL. The specific activity of recombinant human FasL is >1 x 106 IU/mg

Species

Human

Source

E. coli

Tag

N-His

Accession

P48023 (Q130-L281)

Gene ID

356  [NCBI]

Molecular Construction
N-term
His
FasL (Q130-L281)
Accession # P48023
C-term
Synonyms
soluble Fas Ligand (sFasL); TNFSF6; CD95L; Apo I Ligand; APTL; APT1LG1; CD178
AA Sequence

QIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Molecular Weight

Approximately 17.31 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free FasL Protein, Human (His)
Cat. No.:
HY-P700052AF
Quantity:
MCE Japan Authorized Agent: