1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors
  4. IL-12
  5. IL-12 beta
  6. Animal-Free IL-12 beta Protein, Human (His)

Animal-Free IL-12 beta Protein, Human (His)

Cat. No.: HY-P700100AF
COA Handling Instructions

IL-12 beta protein is a multifunctional cytokine that serves as a growth factor for activated T cells and NK cells, amplifies the lytic activity of NK/lymphokine-activated killer cells, and induces IFN production by resting peripheral blood mononuclear cells -γ. peripheral blood mononuclear cells). Animal-Free IL-12 beta Protein, Human (His) is the recombinant human-derived animal-FreeIL-12 beta protein, expressed by E. coli , with His labeled tag. The total length of Animal-Free IL-12 beta Protein, Human (His) is 306 a.a., with molecular weight of ~35.64 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $68 In-stock
10 μg $190 In-stock
50 μg $530 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-12 beta protein is a multifunctional cytokine that serves as a growth factor for activated T cells and NK cells, amplifies the lytic activity of NK/lymphokine-activated killer cells, and induces IFN production by resting peripheral blood mononuclear cells -γ. peripheral blood mononuclear cells). Animal-Free IL-12 beta Protein, Human (His) is the recombinant human-derived animal-FreeIL-12 beta protein, expressed by E. coli , with His labeled tag. The total length of Animal-Free IL-12 beta Protein, Human (His) is 306 a.a., with molecular weight of ~35.64 kDa.

Background

IL-12 beta Protein, a multifunctional cytokine, serves as a growth factor for activated T and NK cells, amplifies the lytic activity of NK/lymphokine-activated killer cells, and induces the production of IFN-gamma by resting peripheral blood mononuclear cells (PBMC). When combined with IL23A, it forms the heterodimeric cytokine IL-23, which plays a pivotal role in both innate and adaptive immunity. This cytokine acts by binding to a receptor complex consisting of IL12RB1 and IL23R, initiating the Jak-Stat signaling cascade. Notably, IL-23 preferentially activates memory T-cells over naive T-cells and fosters the production of pro-inflammatory cytokines. The association of IL-23 with autoimmune inflammation suggests its potential involvement in autoimmune inflammatory diseases and underscores its significance in tumorigenesis.

Species

Human

Source

E. coli

Tag

His

Accession

P29460 (I23-S328)

Gene ID
Synonyms
Interleukin-12 subunit beta; IL-12B; Cytotoxic lymphocyte maturation factor 40 kDa subunit; CLMF p40; IL-12 subunit p40; NK cell stimulatory factor chain 2; NKSF2; IL12B; NKSF2
AA Sequence

MIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS

Molecular Weight

Approximately 35.64 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free IL-12 beta Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IL-12 beta Protein, Human (His)
Cat. No.:
HY-P700100AF
Quantity:
MCE Japan Authorized Agent: