1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors
  4. IL-18
  5. Animal-Free IL-18 Protein, Mouse (His)

Animal-Free IL-18 Protein, Mouse (His)

Cat. No.: HY-P70642AF
COA Handling Instructions

IL-18 protein is a pro-inflammatory cytokine that plays an important role in epithelial barrier repair and immune response regulation by polarizing T helper 1 (Th1) cells and natural killer (NK) cells. After binding to IL18R1 and IL18RAP receptors, IL-18 forms a signaling ternary complex, activates NF-κ-B, and induces inflammatory mediators. Animal-Free IL-18 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-18 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-18 Protein, Mouse (His) is 157 a.a., with molecular weight of ~19.1 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
2 μg $50 In-stock
10 μg $140 In-stock
50 μg $390 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-18 protein is a pro-inflammatory cytokine that plays an important role in epithelial barrier repair and immune response regulation by polarizing T helper 1 (Th1) cells and natural killer (NK) cells. After binding to IL18R1 and IL18RAP receptors, IL-18 forms a signaling ternary complex, activates NF-κ-B, and induces inflammatory mediators. Animal-Free IL-18 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-18 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-18 Protein, Mouse (His) is 157 a.a., with molecular weight of ~19.1 kDa.

Background

IL-18 Protein is a pro-inflammatory cytokine that plays a crucial role in epithelial barrier repair and the modulation of immune responses by polarizing T-helper 1 (Th1) cells and natural killer (NK) cells. Upon binding to its receptors IL18R1 and IL18RAP, IL-18 forms a signaling ternary complex that activates NF-kappa-B, leading to the synthesis of inflammatory mediators. It synergizes with IL-12/interleukin-12 to induce the synthesis of IFNG from Th1 cells and NK cells. IL-18 is also involved in transducing inflammation downstream of pyroptosis, where its mature form is specifically released into the extracellular space through the gasdermin-D (GSDMD) pore. At the plasma membrane, IL-18 forms a ternary complex with IL18R1 and IL18RAP, with IL18 first binding to IL18R1 to form a low affinity binary complex, which then interacts with IL18RAP to form a high affinity ternary complex that signals within the cell. Additionally, IL-18 interacts with the cargo receptor TMED10 to facilitate its translocation from the cytoplasm to the endoplasmic reticulum-Golgi intermediate compartment (ERGIC) for secretion.

Biological Activity

Measure by its ability to induce IFN gamma secretion in KG-1 cells. The ED50 for this effect is <0.5 µg/mL.

Species

Mouse

Source

E. coli

Tag

C-His

Accession

P70380 (N36-S192)

Gene ID

16173  [NCBI]

Molecular Construction
N-term
IL-18 (N36-S192)
Accession # P70380
His
C-term
Synonyms
Interleukin-18; Il18; Interferon gamma-inducing factor; IFN-gamma-inducing factor; Interleukin-1 gamma; IL-1 gamma; Igif
AA Sequence

MNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS

Molecular Weight

Approximately 19.1 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free IL-18 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IL-18 Protein, Mouse (His)
Cat. No.:
HY-P70642AF
Quantity:
MCE Japan Authorized Agent: