1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors
  4. IL-36RA
  5. Animal-Free IL-36RN Protein, Mouse (His)

Animal-Free IL-36RN Protein, Mouse (His)

Cat. No.: HY-P700212AF
COA Handling Instructions

IL-36RN Protein inhibits IL36A, IL36B and IL36G receptors by binding to IL1RL2/IL-36R, blocking their association with IL1RAP and inhibiting downstream signaling. It is an important component of the IL-36 signaling system and participates in the local inflammatory response of the epithelial barrier. Animal-Free IL-36RN Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-36RN protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-36RN Protein, Mouse (His) is 155 a.a., with molecular weight of ~17.81 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $81 In-stock
10 μg $227 In-stock
50 μg $635 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-36RN Protein inhibits IL36A, IL36B and IL36G receptors by binding to IL1RL2/IL-36R, blocking their association with IL1RAP and inhibiting downstream signaling. It is an important component of the IL-36 signaling system and participates in the local inflammatory response of the epithelial barrier. Animal-Free IL-36RN Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-36RN protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-36RN Protein, Mouse (His) is 155 a.a., with molecular weight of ~17.81 kDa.

Background

The IL-36RN Protein acts as an inhibitor by binding to the interleukin-36 (IL36A, IL36B, and IL36G) receptor IL1RL2/IL-36R, preventing its association with the coreceptor IL1RAP and inhibiting downstream signaling. This protein is a crucial component of the IL-36 signaling system, which is implicated in local inflammatory responses, particularly in epithelial barriers. Proposed to play a role in skin inflammation and contribute to the innate immune response against fungal pathogens, the IL-36RN Protein may activate an anti-inflammatory signaling pathway by recruiting SIGIRR. Notably, it interacts with the cargo receptor TMED10, facilitating translocation from the cytoplasm to the endoplasmic reticulum-Golgi intermediate compartment (ERGIC) for secretion.

Biological Activity

Measure by its ability to inhibit IL-36 gamma-induced IL-6 secretion in 3T3 cells. The ED50 for this effect is <2 µg/mL

Species

Mouse

Source

E. coli

Tag

C-His

Accession

Q9QYY1 (M2-D156)

Gene ID

54450  [NCBI]

Molecular Construction
N-term
IL-36RN (M2-D156)
Accession # Q9QYY1
His
C-term
Synonyms
IL-36RA; IL-36RA; Interleukin-36 Receptor Antagonist Protein; IL-1RP3; Interleukin-1; Interleukin-1 FamILy Member 5; IL-1F5; Interleukin-1-Like Protein 1; IL-1L1; IL36RN; FIL1D; IL1F5; IL1HY1; IL1RP3
AA Sequence

MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD

Molecular Weight

Approximately 17.81 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

Animal-Free IL-36RN Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IL-36RN Protein, Mouse (His)
Cat. No.:
HY-P700212AF
Quantity:
MCE Japan Authorized Agent: