1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Animal-Free MIF Protein, Human (His)

Animal-Free MIF Protein, Human (His)

Cat. No.: HY-P70288AF
COA Handling Instructions

The MIF protein is a pro-inflammatory cytokine that is critical for the innate immune response against bacterial pathogens. Its presence at sites of inflammation suggests a role in modulating macrophage function to promote host defense. Animal-Free MIF Protein, Human (His) is the recombinant human-derived animal-FreeMIF protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free MIF Protein, Human (His) is 115 a.a., with molecular weight of ~13.28 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
2 μg $60 In-stock
10 μg $170 In-stock
50 μg $480 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The MIF protein is a pro-inflammatory cytokine that is critical for the innate immune response against bacterial pathogens. Its presence at sites of inflammation suggests a role in modulating macrophage function to promote host defense. Animal-Free MIF Protein, Human (His) is the recombinant human-derived animal-FreeMIF protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free MIF Protein, Human (His) is 115 a.a., with molecular weight of ~13.28 kDa.

Background

MIF Protein is a pro-inflammatory cytokine that plays a crucial role in the innate immune response against bacterial pathogens. Its expression at sites of inflammation suggests its involvement in regulating macrophage function in host defense. MIF counteracts the anti-inflammatory effects of glucocorticoids. Although MIF has phenylpyruvate tautomerase and dopachrome tautomerase activity in vitro, the physiological substrate of MIF is still unknown. It remains unclear whether the tautomerase activity is relevant to its cytokine activity.

Species

Human

Source

E. coli

Tag

C-His

Accession

P14174 (M1-A115)

Gene ID
Molecular Construction
N-term
MIF (M1-A115)
Accession # P14174
His
C-term
Synonyms
rHuMacrophage migration inhibitory factor/MIF, His; Macrophage migration inhibitory factor; MIF; MMIF; Glycosylation-inhibiting factor; GLIF; L-dopachrome tautomerase; Phenylpyruvate tautomerase
AA Sequence

MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Molecular Weight

Approximately 13.28 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free MIF Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free MIF Protein, Human (His)
Cat. No.:
HY-P70288AF
Quantity:
MCE Japan Authorized Agent: