1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. SDF-1/CXCL12
  6. Animal-Free SDF-1 alpha/CXCL12 Protein, Mouse (His)

Animal-Free SDF-1 alpha/CXCL12 Protein, Mouse (His)

Cat. No.: HY-P700219AF
COA Handling Instructions

The SDF-1 α/CXCL12 protein acts as a chemoattractant with specific activity on T lymphocytes and monocytes (excluding neutrophils). It activates the CXC chemokine receptor CXCR4, inducing a rapid and transient rise in intracellular calcium ions and promoting chemotaxis. Animal-Free SDF-1 alpha/CXCL12 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeSDF-1 alpha/CXCL12 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free SDF-1 alpha/CXCL12 Protein, Mouse (His) is 69 a.a., with molecular weight of ~8.97 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
2 μg $105 In-stock
10 μg $290 In-stock
50 μg $800 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The SDF-1 α/CXCL12 protein acts as a chemoattractant with specific activity on T lymphocytes and monocytes (excluding neutrophils). It activates the CXC chemokine receptor CXCR4, inducing a rapid and transient rise in intracellular calcium ions and promoting chemotaxis. Animal-Free SDF-1 alpha/CXCL12 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeSDF-1 alpha/CXCL12 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free SDF-1 alpha/CXCL12 Protein, Mouse (His) is 69 a.a., with molecular weight of ~8.97 kDa.

Background

SDF-1 alpha/CXCL12 protein functions as a chemoattractant specifically active on T-lymphocytes and monocytes, excluding neutrophils. It activates the C-X-C chemokine receptor CXCR4, inducing a rapid and transient rise in intracellular calcium ions and promoting chemotaxis. Additionally, it binds to the atypical chemokine receptor ACKR3, activating the beta-arrestin pathway and acting as a scavenger receptor for SDF-1. Moreover, it binds to the allosteric site (site 2) of integrins, activating ITGAV:ITGB3, ITGA4:ITGB1, and ITGA5:ITGB1 in a CXCR4-independent manner. Acting as a positive regulator of monocyte migration and a negative regulator of monocyte adhesion through the LYN kinase, it stimulates migration of monocytes and T-lymphocytes via CXCR4 and ACKR3, while decreasing monocyte adherence to ICAM-1-coated surfaces. The SDF1A/CXCR4 signaling axis inhibits beta-2 integrin LFA-1-mediated adhesion of monocytes to ICAM-1 through LYN kinase. It plays a protective role after myocardial infarction and induces down-regulation and internalization of ACKR3. Crucially, SDF-1 alpha/CXCL12 is indispensable during embryonic development, participating in B-cell lymphopoiesis, myelopoiesis in bone marrow, and heart ventricular septum formation. It stimulates the proliferation of bone marrow-derived B-cell progenitors in the presence of IL7, as well as the growth of stromal cell-dependent pre-B-cells. Existing in monomeric or homodimeric forms, the equilibrium is influenced by non-acidic pH, the presence of multivalent anions, and binding to CXCR4 or heparin. The monomeric form is essential for full chemotactic activity and resistance to ischemia/reperfusion injury, while the dimeric form acts as a partial agonist of CXCR4, stimulating Ca2+ mobilization without chemotactic activity, functioning instead as a selective antagonist that blocks chemotaxis induced by the monomeric form. It interacts with the N-terminus of ACKR3, integrin subunit ITGB3 via the allosteric site (site 2), and TNFAIP6 via the Link domain.

Biological Activity

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR4. The ED50 for this effect is <0.5 ng/mL.

Species

Mouse

Source

E. coli

Tag

C-His

Accession

P40224 (G21-K89)

Gene ID

20315  [NCBI]

Molecular Construction
N-term
CXCL12 (G21-K89)
Accession # P40224
His
C-term
Synonyms
CXCL12; Stromal cell-derived factor 1; SDF-1; 12-O-tetradecanoylphorbol 13-acetate repressed protein 1; TPAR1; C-X-C motif chemokine 12; Pre-B cell growth-stimulating factor; PBSF; Thymic lymphoma cell-stimulating factor; TLSF; Sdf1
AA Sequence

MGKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK

Molecular Weight

Approximately 8.97 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free SDF-1 alpha/CXCL12 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free SDF-1 alpha/CXCL12 Protein, Mouse (His)
Cat. No.:
HY-P700219AF
Quantity:
MCE Japan Authorized Agent: