1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Translocases (EC 7)
  4. ATP1B1 Protein, Human (HEK293, His)

ATP1B1 Protein, Human (HEK293, His)

Cat. No.: HY-P75586
COA Handling Instructions

The ATP1B1 protein is the non-catalytic component of ATP hydrolase and promotes Na(+)/K(+) ion exchange across the plasma membrane. Its regulatory role involves the assembly of α/β heterodimers to control sodium pump levels. ATP1B1 Protein, Human (HEK293, His) is the recombinant human-derived ATP1B1 protein, expressed by HEK293 , with N-His labeled tag. The total length of ATP1B1 Protein, Human (HEK293, His) is 241 a.a., with molecular weight of 40-50 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $50 In-stock
10 μg $85 In-stock
50 μg $220 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The ATP1B1 protein is the non-catalytic component of ATP hydrolase and promotes Na(+)/K(+) ion exchange across the plasma membrane. Its regulatory role involves the assembly of α/β heterodimers to control sodium pump levels. ATP1B1 Protein, Human (HEK293, His) is the recombinant human-derived ATP1B1 protein, expressed by HEK293 , with N-His labeled tag. The total length of ATP1B1 Protein, Human (HEK293, His) is 241 a.a., with molecular weight of 40-50 kDa.

Background

The ATP1B1 protein serves as the non-catalytic component of the active enzyme that catalyzes the hydrolysis of ATP, facilitating the exchange of Na(+) and K(+) ions across the plasma membrane. Its regulatory role is manifested through the assembly of alpha/beta heterodimers, controlling the number of sodium pumps transported to the plasma membrane. Beyond its involvement in ion transport, ATP1B1 plays a vital role in innate immunity by amplifying virus-triggered induction of interferons (IFNs) and interferon-stimulated genes (ISGs). This immune-modulatory function involves the enhancement of TRAF3 and TRAF6 ubiquitination, as well as TAK1 and TBK1 phosphorylation. Additionally, ATP1B1 is implicated in cell adhesion and the establishment of epithelial cell polarity, underscoring its multifaceted contributions to cellular processes beyond ion homeostasis.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

HEK293

Tag

N-6*His

Accession

P05026-1 (E63-S303)

Gene ID

481  [NCBI]

Molecular Construction
N-term
His
ATP1B1 (E63-S303)
Accession # P05026
C-term
Synonyms
Sodium/potassium-transporting ATPase subunit beta-1; ATP1B1; ATP1B
AA Sequence

EFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS

Molecular Weight

Approximately 40-50 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ATP1B1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ATP1B1 Protein, Human (HEK293, His)
Cat. No.:
HY-P75586
Quantity:
MCE Japan Authorized Agent: