1. Recombinant Proteins
  2. CD Antigens Complement System
  3. NK Cell CD Proteins Stem Cell CD Proteins Erythrocyte CD Proteins Complement Regulatory Proteins
  4. CD59
  5. CD59 Protein, Rat (HEK293, His)

CD59 Protein, Rat (HEK293, His)

Cat. No.: HY-P75390
COA Handling Instructions

The CD59 protein is a potent inhibitor of the complement membrane attack complex (MAC) and exerts regulatory control at or after the C5b-8 stage. Its critical role makes CD59 a key regulator in the complement system, preventing overactivation and associated membrane damage. CD59 Protein, Rat (HEK293, His) is the recombinant rat-derived CD59 protein, expressed by HEK293 , with C-His labeled tag. The total length of CD59 Protein, Rat (HEK293, His) is 100 a.a., with molecular weight of 14-16 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $50 In-stock
10 μg $80 In-stock
50 μg $215 In-stock
100 μg $340 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CD59 protein is a potent inhibitor of the complement membrane attack complex (MAC) and exerts regulatory control at or after the C5b-8 stage. Its critical role makes CD59 a key regulator in the complement system, preventing overactivation and associated membrane damage. CD59 Protein, Rat (HEK293, His) is the recombinant rat-derived CD59 protein, expressed by HEK293 , with C-His labeled tag. The total length of CD59 Protein, Rat (HEK293, His) is 100 a.a., with molecular weight of 14-16 kDa.

Background

CD59 Protein emerges as a potent inhibitor of the complement membrane attack complex (MAC) action, exerting its regulatory influence at or after the C5b-8 stage of MAC assembly. This key role positions CD59 as a crucial modulator in the complement system, preventing excessive activation and the subsequent membrane damage associated with uncontrolled MAC formation. By targeting specific stages of the MAC assembly process, CD59 plays a pivotal role in maintaining the delicate balance of complement activation, highlighting its significance in the immune response and safeguarding cellular integrity from complement-mediated damage.

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Human C9 is present at 5 μg/mL, can bind Recombinant Rat CD59. The ED50 for this effect is 2.01 μg/mL.

  • Measured by its binding ability in a functional ELISA. When Recombinant Human C9 is present at 5 μg/mL, can bind Recombinant Rat CD59. The ED50 for this effect is 2.01 μg/mL.
Species

Rat

Source

HEK293

Tag

C-6*His

Accession

P27274 (L23-N100)

Gene ID

25407  [NCBI]

Molecular Construction
N-term
CD59 (M1-N100)
Accession # P27274
His
C-term
Synonyms
CD59 glycoprotein; HRF-20; MAC-IP; MACIF; MIRL; CD59; MIC11; MIN1; MSK21
AA Sequence

LRCYNCLDPVSSCKTNSTCSPNLDACLVAVSGKQVYQQCWRFSDCNAKFILSRLEIANVQYRCCQADLCNKSFEDKPN

Molecular Weight

Approximately 14-16 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD59 Protein, Rat (HEK293, His)
Cat. No.:
HY-P75390
Quantity:
MCE Japan Authorized Agent: