1. Recombinant Proteins
  2. CD Antigens
  3. B Cell CD Proteins
  4. Ig-β/CD79b
  5. CD79B Protein, Rat (HEK293, His)

CD79B Protein, Rat (HEK293, His)

Cat. No.: HY-P75659
COA Handling Instructions

CD79B Protein, also known as B29 or Igβ, is an essential component of the B cell receptor along with immunoglobulin and mb1 (Igα, CD79a) and is absolutely required for B cell development. Rat CD79B protein comprises 228 amino acids, and its amino acid sequence is 85 and 69% identical with the mouse and human counterparts, respectively. The B-cell antigen receptor (BCR) signaling component Igβ (CD79B) and the co-receptor CD19 act as an alternative B-cell signaling module that promotes the survival of B lymphoma and normal B cells via integrated ITAM/PI3K signaling. The loss of CD79B causes a block in N-glycan maturation and accumulation of immature proteins. CD79B Protein, Rat (HEK293, His) is the recombinant rat-derived CD79B protein, expressed by HEK293 , with C-His labeled tag. The total length of CD79B Protein, Rat (HEK293, His) is 133 a.a., with molecular weight of 25-30 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $50 In-stock
10 μg $85 In-stock
50 μg $220 In-stock
100 μg $350 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD79B Protein, also known as B29 or Igβ, is an essential component of the B cell receptor along with immunoglobulin and mb1 (Igα, CD79a) and is absolutely required for B cell development. Rat CD79B protein comprises 228 amino acids, and its amino acid sequence is 85 and 69% identical with the mouse and human counterparts, respectively. The B-cell antigen receptor (BCR) signaling component Igβ (CD79B) and the co-receptor CD19 act as an alternative B-cell signaling module that promotes the survival of B lymphoma and normal B cells via integrated ITAM/PI3K signaling. The loss of CD79B causes a block in N-glycan maturation and accumulation of immature proteins[1][2][3]. CD79B Protein, Rat (HEK293, His) is the recombinant rat-derived CD79B protein, expressed by HEK293 , with C-His labeled tag. The total length of CD79B Protein, Rat (HEK293, His) is 133 a.a., with molecular weight of 25-30 kDa.

Background

The human, murine, and rat B29 (Ig beta, CD79b) genes are highly conserved in sequence and organization and exhibit strict B cell-specific expression. In the human and rat genomes, the B29 gene is located between the skeletal muscle-specific Na-channel alpha subunit (SCN4A) gene and the pituitary-specific growth hormone (GH-N) gene. Rat B29/Ig-β gene was 3.1 kb in length with six exons and was separated by 3.3 and 9.3 kb from Na-channel and GH genes, respectively[1][2].
The B-cell receptor (BCR) consists of surface-bound immunoglobulin (Ig) and a heterodimeric signaling unit comprised of CD79A and CD79B. Upon cognate antigen recognition, the receptor initiates important signals for B-cell development and function[3].

Biological Activity

Immobilized Human CD79B at 2 μg/mL (100 μL/well) can bind Anti-CD79B Antibody. The ED50 for this effect is 0.7885 μg/mL.

  • Immobilized Human CD79B at 2 μg/mL (100 μL/well) can bind Anti-CD79B Antibody. The ED50 for this effect is 0.7885μg/mL.
Species

Rat

Source

HEK293

Tag

C-6*His

Accession

O70153 (V26-D158)

Gene ID

171055  [NCBI]

Molecular Construction
N-term
CD79B (V26-D158)
Accession # O70153
His
C-term
Synonyms
B-cell antigen receptor complex-associated protein beta chain; CD79b; B30; IGB
AA Sequence

VPAMTKSDQPPIFQGSPCSKIWQHPRFAAKKRSSMVKFHCHTDYSGVMTWFRQKGNQRPQELFPEDGHISQTRNGSVYTLTLQNIQYEDNGIYFCQQKCNSTEPDVTDGCGTELLVLGFSTLDQLKRRNTLKD

Molecular Weight

Approximately 25-30 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CD79B Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD79B Protein, Rat (HEK293, His)
Cat. No.:
HY-P75659
Quantity:
MCE Japan Authorized Agent: