CPS1/CPSase I Protein, Human (His)

The CPS1/CPSase I protein is critical in participating in the urea cycle and is essential for the elimination of excess ammonia in urea-bearing animals. This essential enzyme converts toxic ammonia (a byproduct of amino acid catabolism) into urea, promoting safe excretion. CPS1/CPSase I Protein, Human (His) is the recombinant human-derived CPS1/CPSase I protein, expressed by E. coli , with N-His labeled tag. The total length of CPS1/CPSase I Protein, Human (His) is 147 a.a., with molecular weight of ~20.5 kDa.

The CPS1/CPSase I Protein is a key participant in the urea cycle, particularly in ureotelic animals, where it plays a crucial role in the elimination of excess ammonia from the cell. As an essential enzyme in this metabolic pathway, CPS1 is instrumental in converting ammonia, a toxic byproduct of amino acid catabolism, into urea, which can be safely excreted from the body. This enzymatic activity is vital for maintaining nitrogen balance and preventing the accumulation of harmful levels of ammonia, highlighting the indispensable role of CPS1 in the urea cycle and overall nitrogen metabolism in ureotelic organisms.

Human

E. coli

N-His

P31327 (1354G-1500A)

1373  [NCBI]

GFKIPQKGILIGIQQSFRPRFLGVAEQLHNEGFKLFATEATSDWLNANNVPATPVAWPSQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIPLLTNFQVTKLFAEAVQKSRKVDSKSLFHYRQYSAGKAA

Approximately 20.5 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.