1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Phosphatase
  4. Protein tyrosine phosphatases
  5. Dual Specificity Protein Phosphatase 14 (DUSP14)
  6. DUSP14 Protein, Human (His)

DUSP14 Protein, Human (His)

Cat. No.: HY-P76307
Handling Instructions

DUSP14 protein can inactivate MAP kinase and dephosphorylate ERK, JNK and p38 MAP kinase. Its negative regulation extends to TCR signaling, where DUSP14 dephosphorylates the MAP3K7 adapter TAB1, resulting in inactivation. DUSP14 Protein, Human (His-MBP) is the recombinant human-derived DUSP14 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

DUSP14 protein can inactivate MAP kinase and dephosphorylate ERK, JNK and p38 MAP kinase. Its negative regulation extends to TCR signaling, where DUSP14 dephosphorylates the MAP3K7 adapter TAB1, resulting in inactivation. DUSP14 Protein, Human (His-MBP) is the recombinant human-derived DUSP14 protein, expressed by E. coli , with N-His labeled tag.

Background

The DUSP14 Protein assumes a crucial role in the inactivation of MAP kinases, exhibiting dephosphorylation activity towards ERK, JNK, and p38 MAP-kinases. Its negative regulatory function extends to TCR signaling, where DUSP14 dephosphorylates the MAP3K7 adapter TAB1, leading to its inactivation. This mechanism underscores DUSP14's role in modulating the TCR signaling pathway, revealing its involvement in regulating immune responses. The dephosphorylation activity of DUSP14 on key components of MAP kinase cascades highlights its capacity to finely tune cellular signaling, with potential implications for various physiological processes influenced by MAP kinase pathways.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

O95147 (M1-H191)

Gene ID
Molecular Construction
N-term
His-MBP
DUSP14 (M1-H191)
Accession # O95147
C-term
Synonyms
Dual specificity protein phosphatase 14; MKP-L; MKP-6; DUSP14
AA Sequence

MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRH

Molecular Weight

Approximately 21 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
DUSP14 Protein, Human (His)
Cat. No.:
HY-P76307
Quantity:
MCE Japan Authorized Agent: