1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. Epithelial cell CD Proteins Endothelial cell CD Proteins G-Protein-Coupled Receptors (GPCRs)
  4. Frizzled-4/CD344 Frizzled
  5. Frizzled-4
  6. Frizzled-4/CD344 Protein, Rat (HEK293, His)

Frizzled-4/CD344 Protein, Rat (HEK293, His)

Cat. No.: HY-P74142
Handling Instructions

Frizzled-4/CD344 is a Wnt receptor that mainly activates the β-catenin pathway and affects retinal vascularization. As a receptor for Wnt proteins and Norrin protein (NDP), it stimulates LEF/TCF-mediated transcriptional programs. Frizzled-4/CD344 Protein, Rat (HEK293, His) is the recombinant rat-derived Frizzled-4/CD344 protein, expressed by HEK293 , with C-His labeled tag. The total length of Frizzled-4/CD344 Protein, Rat (HEK293, His) is 144 a.a., with molecular weight of ~23-30 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $35 In-stock
10 μg $60 In-stock
50 μg $170 In-stock
100 μg $290 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Frizzled-4/CD344 is a Wnt receptor that mainly activates the β-catenin pathway and affects retinal vascularization. As a receptor for Wnt proteins and Norrin protein (NDP), it stimulates LEF/TCF-mediated transcriptional programs. Frizzled-4/CD344 Protein, Rat (HEK293, His) is the recombinant rat-derived Frizzled-4/CD344 protein, expressed by HEK293 , with C-His labeled tag. The total length of Frizzled-4/CD344 Protein, Rat (HEK293, His) is 144 a.a., with molecular weight of ~23-30 kDa.

Background

Frizzled-4/CD344, a receptor for Wnt proteins, predominantly engages the beta-catenin canonical signaling pathway, initiating a cascade involving disheveled proteins, GSK-3 kinase inhibition, nuclear accumulation of beta-catenin (CTNNB1), and activation of Wnt target genes. Its pivotal role in retinal vascularization is underscored as it acts as a receptor for both Wnt proteins and norrin (NDP), contributing to beta-catenin (CTNNB1) accumulation and stimulation of LEF/TCF-mediated transcriptional programs. Frizzled-4/CD344 can be activated by Wnt protein binding as well as Wnt-independent signaling via norrin (NDP). Additionally, a second pathway involving PKC and calcium fluxes, possibly integrated with the canonical pathway, has been observed for some family members. Implications extend to tissue morphogenesis and intercellular transmission of polarity information. Frizzled-4/CD344's interactions with MAGI3, NDP, and participation in a complex with TSPAN12 and norrin (NDP) emphasize its multifaceted role. The competitive binding of TSKU and interaction with glypican GPC3 further add nuances to its regulatory functions within intricate signaling networks.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Human Frizzled-4, at 0.1μg/mL (100 μL/well) can bind Wnt-5a.The ED50 for this effect is 32.28 ng/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Human Frizzled-4, at 0.1μg/mL (100 μL/well) can bind Wnt-5a.The ED50 for this effect is 32.28 ng/mL.
Species

Rat

Source

HEK293

Tag

C-His

Accession

Q9QZH0/NP_072145.1 (F38-E181)

Gene ID

64558  [NCBI]

Molecular Construction
N-term
FZD4 (F38-E181)
Accession # Q9QZH0/NP_072145.1
His
C-term
Synonyms
CD344; EVR1; FEVR; Frizzled homolog 4 (Drosophila); Frizzled-4; Fz-4; FZD4
AA Sequence

FGDEEERRCDPIRIAMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPDSLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEE

Molecular Weight

Approximately 23-30 kDa due to the glycosylation

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Frizzled-4/CD344 Protein, Rat (HEK293, His)
Cat. No.:
HY-P74142
Quantity:
MCE Japan Authorized Agent: