1. Recombinant Proteins
  2. Receptor Proteins
  3. G-Protein-Coupled Receptors (GPCRs)
  4. Glucagon Receptor
  5. GLP-1 Receptor
  6. GLP1R Protein, Human (HEK293, N-His, C-Myc)

GLP1R Protein, Human (HEK293, N-His, C-Myc)

Cat. No.: HY-P700468
COA Handling Instructions

The GLP1R protein is a G protein-coupled receptor for glucagon-like peptide 1 (GLP-1), which upon ligand binding activates adenylyl cyclase and increases cAMP levels. This interaction critically regulates insulin secretion, affecting cellular responses and metabolic processes associated with GLP-1 signaling. GLP1R Protein, Human (HEK293, N-His, C-Myc) is the recombinant human-derived GLP1R protein, expressed by HEK293 , with C-Myc, N-10*His labeled tag. The total length of GLP1R Protein, Human (HEK293, N-His, C-Myc) is 122 a.a., with molecular weight of 33 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
20 μg $165 In-stock
50 μg $315 In-stock
100 μg $500 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The GLP1R protein is a G protein-coupled receptor for glucagon-like peptide 1 (GLP-1), which upon ligand binding activates adenylyl cyclase and increases cAMP levels. This interaction critically regulates insulin secretion, affecting cellular responses and metabolic processes associated with GLP-1 signaling. GLP1R Protein, Human (HEK293, N-His, C-Myc) is the recombinant human-derived GLP1R protein, expressed by HEK293 , with C-Myc, N-10*His labeled tag. The total length of GLP1R Protein, Human (HEK293, N-His, C-Myc) is 122 a.a., with molecular weight of 33 kDa.

Background

The GLP1R Protein functions as a G-protein coupled receptor for glucagon-like peptide 1 (GLP-1), participating in a signaling cascade upon ligand binding that activates adenylyl cyclase and increases intracellular cAMP levels. This molecular interaction plays a crucial role in regulating insulin secretion in response to GLP-1. The receptor's activation contributes to the modulation of cellular responses and metabolic processes associated with GLP-1 signaling. Notably, the allosteric modulators NNC0640, PF-06372222, and MK-0893 demonstrate inhibitory effects on the increase of intracellular cAMP levels in response to GLP-1, offering potential avenues for pharmacological intervention in this signaling pathway.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Human GLP1R at 2 μg/mL can bind Anti-GLP1R recombinant antibody, the EC50 is ≤95 ng/mL.

Species

Human

Source

HEK293

Tag

C-Myc;N-10*His

Accession

P43220 (R24-Y145)

Gene ID
Molecular Construction
N-term
10*His
GLP1R (R24-Y145)
Accession # P43220
C-term
Synonyms
rHuGlucagon-like peptide 1 receptor/GLP1R, Fc; Glucagon-like peptide 1 receptor; GLP-1 receptor; GLP-1-R
AA Sequence

RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY

Molecular Weight

33 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

GLP1R Protein, Human (HEK293, N-His, C-Myc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GLP1R Protein, Human (HEK293, N-His, C-Myc)
Cat. No.:
HY-P700468
Quantity:
MCE Japan Authorized Agent: