1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. CSF & Receptors
  4. GM-CSF
  5. GM-CSF Protein, Mouse (His)

GM-CSF Protein, Mouse (His)

Cat. No.: HY-P7361A
COA Handling Instructions

GM-CSF Protein, Mouse is a member of colony-stimulating factors which regulates proliferation, differentiation, and survival of hematopoietic cells.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample (2 μg)   Apply now
2 μg $35 In-stock
5 μg $50 In-stock
10 μg $75 In-stock
50 μg $200 In-stock
100 μg $360 In-stock
500 μg $1280 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE GM-CSF Protein, Mouse (His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GM-CSF Protein, Mouse is a member of colony-stimulating factors which regulates proliferation, differentiation, and survival of hematopoietic cells.

Background

Granulocyte Macrophage Colony Stimulating Factor is a member of colony-stimulating factors which regulates proliferation, differentiation, and survival of hematopoietic cells including mature neutrophils, macrophages, and dendritic cells[1].

Biological Activity

Measured in a cell proliferation assay using THP-1 human erythroleukemic cells. The ED50 for this effect is 9.304-24.86 pg/mL, corresponding to a specific activity is 4.023×107-1.075×108 units/mg.

  • Measured in a cell proliferation assay using THP‑1 human erythroleukemic cells. The ED50 for this effect is 9.304-24.86 pg/mL, corresponding to a specific activity is 4.023×107-1.075×108 units/mg.
Species

Mouse

Source

E. coli

Tag

N-6*His

Accession

Q14AD9 (A18-K141)

Gene ID

12981

Molecular Construction
N-term
6*His
GM-CSF (A18-K141)
Accession # Q14AD9
C-term
Synonyms
rMuGM-CSF; CSF-2; GM-CSF
AA Sequence

APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK

Molecular Weight

Approximately 17 kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, 200 mM arginine, pH 8.0 or 50 mM Tris-HCL, 300 mM NaCl, pH 7.4 or 50 mM Tris-HCL, 300 mM NaCl, 300 mM arginine, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

GM-CSF Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GM-CSF Protein, Mouse (His)
Cat. No.:
HY-P7361A
Quantity:
MCE Japan Authorized Agent: