1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interferon & Receptors
  4. IFN-beta
  5. IFN-beta Protein, Mouse (HEK293)

IFN-beta Protein, Mouse (HEK293)

Cat. No.: HY-P73130
COA Handling Instructions

IFN-β protein is a type I interferon that plays a key role in the innate immune response by binding to IFNAR2 and IFNAR1 receptors and activating Jak-STAT signaling. This results in transcriptional regulation of interferon-regulated genes, affecting antiviral proteins, cell proliferation regulators, and immunomodulatory proteins. IFN-beta Protein, Mouse (HEK293) is the recombinant mouse-derived IFN-beta protein, expressed by HEK293 , with tag free. The total length of IFN-beta Protein, Mouse (HEK293) is 161 a.a., with molecular weight of ~28.28 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
2 μg $35 In-stock
5 μg $64 In-stock
10 μg $103 In-stock
20 μg $165 In-stock
50 μg $313 In-stock
100 μg $500 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE IFN-beta Protein, Mouse (HEK293)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IFN-β protein is a type I interferon that plays a key role in the innate immune response by binding to IFNAR2 and IFNAR1 receptors and activating Jak-STAT signaling. This results in transcriptional regulation of interferon-regulated genes, affecting antiviral proteins, cell proliferation regulators, and immunomodulatory proteins. IFN-beta Protein, Mouse (HEK293) is the recombinant mouse-derived IFN-beta protein, expressed by HEK293 , with tag free. The total length of IFN-beta Protein, Mouse (HEK293) is 161 a.a., with molecular weight of ~28.28 kDa.

Background

IFN-beta Protein, a type I interferon cytokine, assumes a pivotal role in the innate immune response to infections, tumors, and various inflammatory stimuli. Its signaling involves binding to the high-affinity receptor IFNAR2 and the low-affinity receptor IFNAR1, forming a heterodimeric complex and activating the canonical Jak-STAT signaling pathway. This activation results in the transcriptional modulation of interferon-regulated genes, encompassing antiviral proteins, regulators of cell proliferation and differentiation, and immunoregulatory proteins. While predominantly signaling through the IFNAR1-IFNAR2 heterodimeric receptor, IFN-beta can also function with IFNAR1 alone, operating independently of Jak-STAT pathways. IFN-beta elicits diverse responses, including antiviral and antibacterial activities, and influences B-cell development, myelopoiesis, and lipopolysaccharide (LPS)-inducible production of tumor necrosis factor. Beyond its immune functions, IFN-beta plays a crucial role in neuronal homeostasis by regulating dopamine turnover and protecting dopaminergic neurons, promoting neuronal autophagy, and facilitating alpha-synuclein clearance, thereby preventing dopaminergic neuron loss. Notably, IFN-beta demonstrates greater potency than interferon-alpha (IFN-alpha) in inducing apoptotic and antiproliferative pathways crucial for controlling tumor cell growth. It functions as a monomer in these regulatory processes.

Biological Activity

1. Measured in antiviral assays using L929 cells infected with vesicular stomatitisvirus (VSV) and the ED50 is 3-18 pg/mL.
2. Determined by a cytotoxicity assay using human TF-1 cells. The ED50 this effect is ≤0.3901 ng/mL, corresponding to a specific activity is ≥2.563×10^6 units/mg.

  • Determined by a cytotoxicity assay using human TF-1 cells. The ED50 for this effect is 0.3901 ng/mL, corresponding to a specific activity is 2.563×106 units/mg.
Species

Mouse

Source

HEK293

Tag

Tag Free

Accession

P01575 (I22-N182)

Gene ID

15977  [NCBI]

Molecular Construction
N-term
IFN-beta (I22-N182)
Accession # P01575
C-term
Synonyms
Interferon beta; IFN-beta; IFNB1; IFB; IFNB
AA Sequence

INYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQN

Molecular Weight

Approximately 24-33 kDa due to the glycosylation.

Purity

Greater than 90% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IFN-beta Protein, Mouse (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IFN-beta Protein, Mouse (HEK293)
Cat. No.:
HY-P73130
Quantity:
MCE Japan Authorized Agent: