1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-32
  5. IL-32 Protein, Human (HEK293, His)

IL-32 Protein, Human (HEK293, His)

Cat. No.: HY-P73884
COA Handling Instructions

IL-32 protein is a member of the cytokine family whose expression increases following T cell activation or IL-2-induced NK cell activation. It plays a key role in inducing macrophages to produce TNFα, which contributes to the inflammatory response. IL-32 Protein, Human (HEK293, His) is the recombinant human-derived IL-32 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
100 μg $820 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-32 protein is a member of the cytokine family whose expression increases following T cell activation or IL-2-induced NK cell activation. It plays a key role in inducing macrophages to produce TNFα, which contributes to the inflammatory response. IL-32 Protein, Human (HEK293, His) is the recombinant human-derived IL-32 protein, expressed by HEK293 , with C-His labeled tag.

Background

IL-32 Protein, a member of the cytokine family, is characterized by features such as a tyrosine sulfation site, three potential N-myristoylation sites, multiple putative phosphorylation sites, and an RGD cell-attachment sequence. Its expression is notably increased following the activation of T-cells by mitogens or the activation of NK cells by IL-2. IL-32 plays a pivotal role in inducing the production of TNFalpha from macrophage cells, implicating its involvement in inflammatory responses. The gene exhibits alternative transcriptional splice variants, giving rise to different isoforms with distinct functional characteristics. IL-32 demonstrates broad expression across various tissues, with substantial levels observed in the small intestine (RPKM 122.1), spleen (RPKM 121.0), and 22 other tissues, underscoring its diverse roles and potential contributions to immune modulation and tissue-specific functions.

Biological Activity

Measured by its ability to induce TNF-alpha secretion by RAW 264.7 mouse monocyte/macrophage cells. The ED50 for this effect is 1.452 μg/mL in the presence of 5 μg/mL MDP. Corresponding to a specific activity is 688.705 U/mg.

Species

Human

Source

HEK293

Tag

C-His

Accession

P24001-4/NP_001012651 (M1-K131)

Gene ID
Molecular Construction
N-term
IL-32 (M1-K131)
Accession # NP_001012651
His
C-term
Synonyms
Interleukin-32; IL-32; NK4; TAIF
AA Sequence

MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKSYGAPRGDKEELTPQKCSEPQSSK

Molecular Weight

Approximately 19-23 kDa due to the phosphorylation

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-32 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-32 Protein, Human (HEK293, His)
Cat. No.:
HY-P73884
Quantity:
MCE Japan Authorized Agent: