1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2) Serine/Threonine Kinase Proteins Protein Tyrosine Kinases
  4. MAP2K6 Protein, Human (Baculovirus, His)

MAP2K6 Protein, Human (Baculovirus, His)

Cat. No.: HY-P700592
Handling Instructions

The MKK6 protein is a dual-specificity kinase involved in the MAP kinase pathway. MAP2K6 Protein, Human (Baculovirus, His) is the recombinant human-derived MAP2K6 protein, expressed by Sf9 insect cells , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The MKK6 protein is a dual-specificity kinase involved in the MAP kinase pathway. MAP2K6 Protein, Human (Baculovirus, His) is the recombinant human-derived MAP2K6 protein, expressed by Sf9 insect cells , with N-6*His labeled tag.

Background

MKK6, a dual specificity protein kinase, serves as an integral component of the MAP kinase signal transduction pathway. In collaboration with MAP3K3/MKK3, MKK6 catalyzes the simultaneous phosphorylation of a threonine and a tyrosine residue in the MAP kinases p38 MAPK11, MAPK12, MAPK13, and MAPK14, playing a pivotal role in regulating cellular responses to cytokines and various stress stimuli. Both MKK3 and MKK6 are essential for activating MAPK11 and MAPK13 in response to environmental stress, with MKK6 emerging as the principal activator of MAPK11 upon TNF stimulation. Additionally, MKK6 phosphorylates and activates PAK6. The downstream effects of the p38 MAP kinase signal transduction pathway include the direct activation of transcription factors such as ATF2 and ELK1. Within this pathway, MKK6 mediates the phosphorylation of STAT4 through MAPK14 activation, leading to the activation of STAT4 and its regulation of gene expression in response to IL-12 stimulation. Furthermore, the pathway is crucial for IL-6-induced SOCS3 expression and down-regulation of IL-6-mediated gene induction, as well as IFNG-dependent gene transcription. MKK6 plays a role in osteoclast differentiation through NF-kappa-B transactivation by TNFSF11, contributes to endochondral ossification, and likely influences SOX9 as a downstream target of the p38 MAPK pathway. Moreover, MKK6 is involved in mediating apoptotic cell death in thymocytes and serves as a regulator for melanocyte dendricity by modulating Rho family GTPases.

Species

Human

Source

Sf9 insect cells

Tag

N-6*His

Accession

P52564-1 (M1-D334)

Gene ID
Molecular Construction
N-term
6*His
MAP2K6 (M1-D334)
Accession # P52564-1
C-term
Synonyms
MAP2K6; mitogen-activated protein kinase kinase 6; MEK6; MKK6; MAPKK6; PRKMK6; SAPKK3; protein kinase, mitogen-activated, kinase 6 (MAP kinase kinase 6); EC 2.7.12.2; Dual specificity mitogen-activated protein kinase kinase 6; MAP kinase kinase 6; MAPK/ERK kinase 6
AA Sequence

MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD

Molecular Weight

39.5 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MAP2K6 Protein, Human (Baculovirus, His)
Cat. No.:
HY-P700592
Quantity:
MCE Japan Authorized Agent: