1. Recombinant Proteins
  2. Others
  3. PAEP Protein, Human (HEK293, His)

PAEP Protein, Human (HEK293, His)

Cat. No.: HY-P700004
COA Handling Instructions

PAEP protein is a glycoprotein that regulates fertilization steps and exhibits immunomodulatory effects. PAEP Protein, Human (HEK293, His) is the recombinant human-derived PAEP protein, expressed by HEK293 , with N-10*His labeled tag.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
50 μg $778 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PAEP protein is a glycoprotein that regulates fertilization steps and exhibits immunomodulatory effects. PAEP Protein, Human (HEK293, His) is the recombinant human-derived PAEP protein, expressed by HEK293 , with N-10*His labeled tag.

Background

The PAEP Protein, a glycoprotein, intricately regulates crucial steps during fertilization while also exerting immunomodulatory effects. In reproductive tissues, four distinct glycoforms—namely glycodelin-S, -A, -F, and -C—have been identified, each characterized by unique glycosylation patterns and biological activities. Glycodelin-A, for instance, exhibits both contraceptive and immunosuppressive activities. On the other hand, Glycodelin-C plays a role in stimulating the binding of spermatozoa to the zona pellucida. In contrast, Glycodelin-F serves to inhibit spermatozoa-zona pellucida binding and significantly suppresses the progesterone-induced acrosome reaction of spermatozoa. Additionally, Glycodelin-S, present in seminal plasma, maintains the uncapacitated state of human spermatozoa. The protein forms a homodimer, further emphasizing its structural complexity and functional diversity in orchestrating key events during fertilization and modulating immune responses.

Biological Activity

Data is not available.

Species

Human

Source

HEK293

Tag

N-10*His

Accession

P09466-1 (M19-F180)

Gene ID
Molecular Construction
N-term
10*His
PAEP (M19-F180)
Accession # P09466-1
C-term
Synonyms
Alpha uterine protein; gD; GdA; GdF; GdS; Glycodelin A; Glycodelin; Glycodelin F; Glycodelin S; MGC138509; MGC142288; PAEG
AA Sequence

MDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF

Molecular Weight

Approximately 18.06 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE
Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 30% glycerin, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

PAEP Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PAEP Protein, Human (HEK293, His)
Cat. No.:
HY-P700004
Quantity:
MCE Japan Authorized Agent: