1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Protein Kinase Inhibitor Peptide (PKI)
  4. cAMP-Dependent Protein Kinase A Inhibitor beta
  5. PKI-beta Protein, Human (His)

PKI-beta Protein, Human (His)

Cat. No.: HY-P71209
COA Handling Instructions

The PKI-β protein emerged as an extremely potent competitive inhibitor of cAMP-dependent protein kinase activity. This protein operates at the molecular level, binding to the catalytic subunit of the enzyme after cAMP induces dissociation of its regulatory chain. PKI-beta Protein, Human (His) is the recombinant human-derived PKI-beta protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $170 In-stock
50 μg $510 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PKI-β protein emerged as an extremely potent competitive inhibitor of cAMP-dependent protein kinase activity. This protein operates at the molecular level, binding to the catalytic subunit of the enzyme after cAMP induces dissociation of its regulatory chain. PKI-beta Protein, Human (His) is the recombinant human-derived PKI-beta protein, expressed by E. coli , with N-6*His labeled tag.

Background

The PKI-beta protein is an exceptionally potent competitive inhibitor of cAMP-dependent protein kinase activity. Functioning as a regulatory molecule, PKI-beta exerts its inhibitory action by interacting with the catalytic subunit of the enzyme, particularly after the cAMP-induced dissociation of its regulatory chains. This regulatory mechanism underscores the dynamic nature of cAMP-dependent protein kinase activity and the pivotal role of PKI-beta in modulating this signaling pathway. By tightly regulating the catalytic subunit, PKI-beta plays a crucial role in modulating cellular responses to cAMP signaling, contributing to the fine-tuning of intracellular processes influenced by this important kinase, such as those related to cell growth, metabolism, and gene expression.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q9C010-1 (M1-K78)

Gene ID
Molecular Construction
N-term
6*His
PKI-beta (M1-K78)
Accession # Q9C010-1
C-term
Synonyms
cAMP-Dependent Protein Kinase Inhibitor Beta; PKI-beta; PKIB; PRKACN2
AA Sequence

MRTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSVKEDAKEKDEKTTQDQLEKPQNEEK

Molecular Weight

Approximately 14.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 100 mM NaCl, 1 mM DTT, 20% Glycerol, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PKI-beta Protein, Human (His)
Cat. No.:
HY-P71209
Quantity:
MCE Japan Authorized Agent: