1. Recombinant Proteins
  2. Others
  3. S100A6 Protein, Human (His)

S100A6 Protein, Human (His)

Cat. No.: HY-P71082
COA Handling Instructions

The S100A6 protein is a key calcium sensor that actively promotes cellular calcium signaling and is involved in multiple processes, including actin cytoskeletal reorganization and cell motility. As a homodimer binding two calcium ions, it interacts with TPR-containing proteins, CACYBP, ANXA2, ANXA11, SUGT1, tropomyosin, TP53, PPP5C, and TPPP. S100A6 Protein, Human (His) is the recombinant human-derived S100A6 protein, expressed by E. coli , with N-6*His labeled tag. The total length of S100A6 Protein, Human (His) is 90 a.a., with molecular weight of ~12.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $50 In-stock
50 μg $140 In-stock
100 μg $238 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The S100A6 protein is a key calcium sensor that actively promotes cellular calcium signaling and is involved in multiple processes, including actin cytoskeletal reorganization and cell motility. As a homodimer binding two calcium ions, it interacts with TPR-containing proteins, CACYBP, ANXA2, ANXA11, SUGT1, tropomyosin, TP53, PPP5C, and TPPP. S100A6 Protein, Human (His) is the recombinant human-derived S100A6 protein, expressed by E. coli , with N-6*His labeled tag. The total length of S100A6 Protein, Human (His) is 90 a.a., with molecular weight of ~12.0 kDa.

Background

The S100A6 Protein serves as a pivotal calcium sensor and modulator, actively contributing to cellular calcium signaling. Through interactions with various proteins, including TPR-containing proteins, S100A6 indirectly participates in diverse physiological processes, such as the reorganization of the actin cytoskeleton and cell motility. Existing as a homodimer with a head-to-tail assembly of two subunits, S100A6 binds two calcium ions in a cooperative manner. Its calcium-dependent interaction with CACYBP, ANXA2, ANXA11, SUGT1, and tropomyosin reveals its role in orchestrating complex molecular interactions. Moreover, S100A6 interacts with TP53, displaying higher affinity for TP53 phosphorylated on its N-terminal domain and lower affinity for TP53 phosphorylated on its C-terminal domain. The interaction with PPP5C, mediated by TPR repeats, is calcium-dependent and modulates PPP5C activity, emphasizing S100A6's regulatory influence in cellular processes. Additionally, its interaction with TPPP inhibits TPPP dimerization, as reported in recent studies.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P06703 (M1-G90)

Gene ID
Molecular Construction
N-term
6*His
S100A6 (M1-G90)
Accession # P06703
C-term
Synonyms
S100A6; Protein S100-A6; Calcyclin; Growth factor-inducible protein 2A9; MLN 4; Prolactin receptor-associated protein; PRA; S100 calcium-binding protein A6; CACY
AA Sequence

MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG

Molecular Weight

Approximately 12.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 20% Glycerol, 1 mM EDTA, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

S100A6 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
S100A6 Protein, Human (His)
Cat. No.:
HY-P71082
Quantity:
MCE Japan Authorized Agent: