1. Recombinant Proteins
  2. Others
  3. SINHCAF Protein, Human (GST)

SINHCAF Protein, Human (GST)

Cat. No.: HY-P700391
Handling Instructions

SINHCAF is a key subunit of the Sin3 deacetylase complex (Sin3/HDAC) and is essential for inhibiting genes related to the TGF-β signaling pathway. In embryonic stem (ES) cells, SINHCAF forms the SIN3A complex together with SIN3A, HDAC1, SAP30, RBBP4, OGT, and TET1. SINHCAF Protein, Human (GST) is the recombinant human-derived SINHCAF protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SINHCAF is a key subunit of the Sin3 deacetylase complex (Sin3/HDAC) and is essential for inhibiting genes related to the TGF-β signaling pathway. In embryonic stem (ES) cells, SINHCAF forms the SIN3A complex together with SIN3A, HDAC1, SAP30, RBBP4, OGT, and TET1. SINHCAF Protein, Human (GST) is the recombinant human-derived SINHCAF protein, expressed by E. coli , with N-GST labeled tag.

Background

SINHCAF, a crucial subunit of the Sin3 deacetylase complex (Sin3/HDAC), plays a pivotal role in the repression of genes encoding components of the TGF-beta signaling pathway. As a core component of the SIN3A complex in embryonic stem (ES) cells, SINHCAF collaborates with SIN3A, HDAC1, SAP30, RBBP4, OGT, and TET1. This complex is essential for maintaining the rapid proliferation potential of ES cells while ensuring a short G1-phase of the cell cycle, thereby preventing premature lineage priming. Moreover, SINHCAF promotes the stability of SIN3A and facilitates its presence on chromatin. It interacts with the Sin3/HDAC corepressor complex, which includes BRMS1, BRMS1L, ING2, SAP30, SAP30L, and HDAC1, emphasizing its involvement in intricate regulatory networks. Additionally, SINHCAF interacts directly with SIN3A and OGT, underscoring its integral role in the molecular interactions that govern gene expression and cellular processes in ES cells.

Species

Human

Source

E. coli

Tag

N-GST

Accession

Q9NP50-1 (M1-W221)

Gene ID
Molecular Construction
N-term
GST
SINHCAF (M1-W221)
Accession # Q9NP50-1
C-term
Synonyms
Protein FAM60A; Tera protein homolog; C12orf14; FAM60A
AA Sequence

MFGFHKPKMYRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLHETRSGDICNACVLLVKRWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRIKSNQISKLQKEFKRHNSDAHSTTSSASPAQSPCYSNQSDDGSDTEMASGSNRTPVFSFLDLTYWKRQKICCGIIYKGRFGEVLIDTHLFKPCCSNKKAAAEKPEEQGPEPLPISTQEW

Molecular Weight

51.9 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

SINHCAF Protein, Human (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SINHCAF Protein, Human (GST)
Cat. No.:
HY-P700391
Quantity:
MCE Japan Authorized Agent: