1. Recombinant Proteins
  2. Others
  3. Thioredoxin-1/TRXA Protein, E.coli (His)

Thioredoxin-1/TRXA Protein, E.coli (His)

Cat. No.: HY-P71496
Handling Instructions

Thioredoxin-1/TRXA Protein participates in diverse redox reactions, facilitating reversible oxidation of its active center dithiol to form a disulfide bond and catalyzing critical dithiol-disulfide exchanges. Operating as a monomer, Thioredoxin-1 exhibits versatility in redox functions and interacts with bacteriophage T3 DNA polymerase, suggesting broader involvement in molecular processes beyond its primary redox activities. Thioredoxin-1/TRXA Protein, E.coli (His) is the recombinant E. coli-derived Thioredoxin-1/TRXA protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Thioredoxin-1/TRXA Protein participates in diverse redox reactions, facilitating reversible oxidation of its active center dithiol to form a disulfide bond and catalyzing critical dithiol-disulfide exchanges. Operating as a monomer, Thioredoxin-1 exhibits versatility in redox functions and interacts with bacteriophage T3 DNA polymerase, suggesting broader involvement in molecular processes beyond its primary redox activities. Thioredoxin-1/TRXA Protein, E.coli (His) is the recombinant E. coli-derived Thioredoxin-1/TRXA protein, expressed by E. coli , with N-His labeled tag.

Background

Thioredoxin-1/TRXA Protein actively engages in diverse redox reactions by facilitating the reversible oxidation of its active center dithiol to form a disulfide bond, and it catalyzes critical dithiol-disulfide exchange reactions. Operating as a monomer, Thioredoxin-1 demonstrates versatility in its redox functions. Notably, it interacts with bacteriophage T3 DNA polymerase, suggesting its involvement in molecular processes beyond its primary redox activities.

Species

E.coli

Source

E. coli

Tag

N-His

Accession

P0AA25 (S2-A109)

Gene ID

69484444  [NCBI]

Molecular Construction
N-term
His
TRXA (S2-A109)
Accession # P0AA25
C-term
Synonyms
trxA; fipA; tsnC; b3781; JW5856; Thioredoxin 1; Trx-1
AA Sequence

SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA

Molecular Weight

Approximately 15.7 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Thioredoxin-1/TRXA Protein, E.coli (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Thioredoxin-1/TRXA Protein, E.coli (His)
Cat. No.:
HY-P71496
Quantity:
MCE Japan Authorized Agent: