1. Recombinant Proteins
  2. Others
  3. Thioredoxin/TXN Protein, E.coli (His)

Thioredoxin/TXN Protein, E.coli (His)

Cat. No.: HY-P7802
COA Handling Instructions

Thioredoxin/TXN Protein, E.coli (His) is a hydrogen carrier protein and exists widely in organism. Thioredoxin suppression disbalances insulin responsiveness in chicken cardiomyocytes through PI3K/Akt pathway inhibition.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $35 In-stock
50 μg $72 In-stock
250 μg $200 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Thioredoxin/TXN Protein, E.coli (His) is a hydrogen carrier protein and exists widely in organism. Thioredoxin suppression disbalances insulin responsiveness in chicken cardiomyocytes through PI3K/Akt pathway inhibition[1][2].

Background

Thioredoxin (Txn) is a hydrogen carrier protein and exists widely in organism. Txn deficiency implicates cardiomyocytes injury has been proven. Thioredoxin (Txn) system is the most crucial antioxidant defense mechanism in cell consisting of Txn, thioredoxin reductase (TR) and Nicotinamide Adenine Dinucleotide Phosphate (NADPH). Txn system can redox regulate the insulin dependent glucose metabolism in heart and is essential for cell vitality[1][2].

Biological Activity

Its ability to catalyze the reduction of insuline by precipitation reaction measured by absorbance at 650 nm. The specific activity is 3 units/mg, as measured under the described conditions.

Species

E.coli

Source

E. coli

Tag

His

Accession

M26133 (M1-A109)

Gene ID

948289  [NCBI]

Synonyms
rEcoThioredoxin/TXN, His; Trx; ADF; TRX1
AA Sequence

MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA

Molecular Weight

Approximately 13 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filter solution of 50 mM Tris-HCl, 0.15 M NaCl, 1 mM EDTA, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Thioredoxin/TXN Protein, E.coli (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Thioredoxin/TXN Protein, E.coli (His)
Cat. No.:
HY-P7802
Quantity:
MCE Japan Authorized Agent: