1. Recombinant Proteins
  2. Others
  3. TM2D1 Protein, Human (HEK293, Fc)

TM2D1 Protein, Human (HEK293, Fc)

Cat. No.: HY-P77238
COA Handling Instructions

The TM2D1 protein may be involved in amyloid beta-induced apoptosis by interacting with beta-APP42, especially amyloid beta protein 42 (APP beta-APP42). This suggests a role in molecular pathways associated with amyloid-induced cell death. TM2D1 Protein, Human (HEK293, Fc) is the recombinant human-derived TM2D1 protein, expressed by HEK293 , with C-mFc labeled tag. The total length of TM2D1 Protein, Human (HEK293, Fc) is 81 a.a., with molecular weight of 45-60 KDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $55 In-stock
10 μg $85 In-stock
50 μg $215 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The TM2D1 protein may be involved in amyloid beta-induced apoptosis by interacting with beta-APP42, especially amyloid beta protein 42 (APP beta-APP42). This suggests a role in molecular pathways associated with amyloid-induced cell death. TM2D1 Protein, Human (HEK293, Fc) is the recombinant human-derived TM2D1 protein, expressed by HEK293 , with C-mFc labeled tag. The total length of TM2D1 Protein, Human (HEK293, Fc) is 81 a.a., with molecular weight of 45-60 KDa.

Background

The TM2D1 protein is suggested to potentially participate in amyloid-beta-induced apoptosis through its interaction with beta-APP42, specifically interacting with amyloid-beta protein 42 (APP beta-APP42). This implies a role for TM2D1 in the molecular pathways associated with amyloid-beta-induced cell death, particularly through its association with the beta-APP42 protein. The precise mechanisms and consequences of this interaction remain areas of interest, highlighting TM2D1's potential involvement in cellular processes related to amyloid-beta signaling and apoptosis.

Species

Human

Source

HEK293

Tag

C-mFc

Accession

Q9BX74/NP_114416.1 (T38-G118)

Gene ID

83941  [NCBI]

Molecular Construction
N-term
TM2D1 (T38-G118)
Accession # Q9BX74/NP_114416.1
mFc
C-term
Synonyms
TM2 domain-containing protein 1; Amyloid-beta-binding protein; hBBP; BBP
AA Sequence

TSAGGEESLKCEDLKVGQYICKDPKINDATQEPVNCTNYTAHVSCFPAPNITCKDSSGNETHFTGNEVGFFKPISCRNVNG

Molecular Weight

Approximately 45-60 kDa band in SDS-PAGE under reducing conditions due to the glycosylation.

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TM2D1 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TM2D1 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P77238
Quantity:
MCE Japan Authorized Agent: