1. Recombinant Proteins
  2. Others
  3. Type-1A pilin/fimA Protein, E.coli (His-SUMO)

Type-1A pilin/fimA Protein, E.coli (His-SUMO)

Cat. No.: HY-P71504
Handling Instructions

Type 1A pilins, also known as fimA proteins, promote bacterial colonization by forming pili, or fimbriae (polar filaments extending from the surface of bacteria, reaching 0.5-1.5 microns in length and 100-300 per cell) . These pili play a crucial role in promoting bacterial adhesion to the epithelium of specific host organs. Type-1A pilin/fimA Protein, E.coli (His-SUMO) is the recombinant E. coli-derived Type-1A pilin/fimA protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Type 1A pilins, also known as fimA proteins, promote bacterial colonization by forming pili, or fimbriae (polar filaments extending from the surface of bacteria, reaching 0.5-1.5 microns in length and 100-300 per cell) . These pili play a crucial role in promoting bacterial adhesion to the epithelium of specific host organs. Type-1A pilin/fimA Protein, E.coli (His-SUMO) is the recombinant E. coli-derived Type-1A pilin/fimA protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Background

Type-1A pilin, encoded by the fimA gene, is a key component of bacterial fimbriae or pili, which are polar filaments extending from the surface of the bacterium to lengths of 0.5-1.5 micrometers, numbering 100-300 per cell. These fimbriae play a crucial role in facilitating bacterial colonization of the epithelium of specific host organs. The fimA protein is integral to the structure and function of these fimbriae, enabling bacterial adhesion to host tissues and promoting interactions that are essential for successful colonization.

Species

E.coli

Source

E. coli

Tag

N-His;N-SUMO

Accession

P04128 (A24-Q182)

Gene ID

948838  [NCBI]

Molecular Construction
N-term
6*His-SUMO
fimA (A24-Q182)
Accession # P04128
C-term
Synonyms
fimA; pilA; b4314; JW4277Type-1 fimbrial protein; A chain; Type-1A pilin
AA Sequence

AATTVNGGTVHFKGEVVNAACAVDAGSVDQTVQLGQVRTASLAQEGATSSAVGFNIQLNDCDTNVASKAAVAFLGTAIDAGHTNVLALQSSAAGSATNVGVQILDRTGAALTLDGATFSSETTLNNGTNTIPFQARYFATGAATPGAANADATFKVQYQ

Molecular Weight

Approximately 31.8 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Type-1A pilin/fimA Protein, E.coli (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Type-1A pilin/fimA Protein, E.coli (His-SUMO)
Cat. No.:
HY-P71504
Quantity:
MCE Japan Authorized Agent: