1. Others
  2. Others
  3. TAT-p16

TAT-p16 (p16INK4a peptide) is a peptide mimic of p16INK4a that can induce an early G phase cell cycle arrest in the absence of active cyclin E:Cdk2 complex.

For research use only. We do not sell to patients.

TAT-p16 Chemical Structure

TAT-p16 Chemical Structure

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

TAT-p16 (p16INK4a peptide) is a peptide mimic of p16INK4a that can induce an early G[1] phase cell cycle arrest in the absence of active cyclin E:Cdk2 complex[1].

In Vitro

TAT-p16 (10-100 μM; 30 h) leads to a significant G1 phase cell cycle arrest in human HaCaT keratinocytes[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

3722.28

Formula

C159H274N64O40

Unlabeled CAS

Sequence

Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Asp-Ala-Ala-Arg-Glu-Gly-Phe-Leu-Ala-Thr-Leu-Val-Val-Leu-His-Arg-Ala-Gly-Ala-Arg

Sequence Shortening

YGRKKRRQRRRGDAAREGFLATLVVLHRAGAR

SMILES

O=C(NCC(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCCN)C(N[C@@H](CCCCN)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCC(N)=O)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCNC(N)=N)C(NCC(N[C@@H](CC(O)=O)C(N[C@@H](C)C(N[C@@H](C)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCC(O)=O)C(NCC(N[C@@H](CC1=CC=CC=C1)C(N[C@@H](CC(C)C)C(N[C@@H](C)C(N[C@@H]([C@H](O)C)C(N[C@@H](CC(C)C)C(N[C@@H](C(C)C)C(N[C@@H](C(C)C)C(N[C@@H](CC(C)C)C(N[C@@H](CC2=CNC=N2)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](C)C(NCC(N[C@@H](C)C(N[C@@H](CCCNC(N)=N)C(O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)[C@H](CC3=CC=C(C=C3)O)N

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

TAT-p16 Related Classifications

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TAT-p16
Cat. No.:
HY-P10324
Quantity:
MCE Japan Authorized Agent: