1. Others
  2. Others
  3. Teriparatide acetate hydrate

Teriparatide acetate hydrate  (Synonyms: Human parathyroid hormone-(1-34) (acetate hydrate); hPTH (1-34) (acetate hydrate))

Cat. No.: HY-P0059A
Handling Instructions

Teriparatide acetate hydrate (Human parathyroid hormone-(1-34) acetate hydrate) is a PTH1 receptor agonist. Teriparatide acetate hydrate (Human parathyroid hormone-(1-34) acetate hydrate) can be used for osteoporosis research.

For research use only. We do not sell to patients.

Teriparatide acetate hydrate Chemical Structure

Teriparatide acetate hydrate Chemical Structure

CAS No. : 99294-94-7

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other In-stock Forms of Teriparatide acetate hydrate:

Other Forms of Teriparatide acetate hydrate:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Teriparatide acetate hydrate (Human parathyroid hormone-(1-34) acetate hydrate) is a PTH1 receptor agonist. Teriparatide acetate hydrate (Human parathyroid hormone-(1-34) acetate hydrate) can be used for osteoporosis research[1].

In Vivo

Teriparatide acetate hydrate (Human parathyroid hormone-(1-34) acetate hydrate) (20 μg/kg, i.h.; daily, for 4 weeks; female New Zealand white rabbits) increases the cortical thickness and porosity[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Female New Zealand white rabbits[1]
Dosage: 20 μg/kg
Administration: Subcutaneous injection; daily, for 4 weeks
Result: Increased the pore ratio, number, and density as well as the cortical area, thickness, and bone mineral content (BMC), without significant influencing the volumetric bone mineral density (BMD).
Clinical Trial
Formula

C181H291N55O51S2.C2H4O2.xH2O

CAS No.
Unlabeled CAS

Sequence Shortening

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

SMILES

[SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF (acetate salt, hydrate)]

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Teriparatide acetate hydrate Related Classifications

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Teriparatide acetate hydrate
Cat. No.:
HY-P0059A
Quantity:
MCE Japan Authorized Agent: