1. Peptides
  2. Peptide and Derivatives
  3. Hormones and Neuropeptides
  4. [Tyr0] Corticotropin Releasing Factor, ovine

[Tyr0] Corticotropin Releasing Factor, ovine 

Cat. No.: HY-P3687
Handling Instructions

[Tyr0] Corticotropin Releasing Factor, ovine is a corticotropin releasing factor/hormone isolated from ovine. Corticotropin releasing factor (CRF) is a hypothalamic hormone, stimulates the release of adrenocorticotropic hormone (ACTH) and of β-endorphin.

For research use only. We do not sell to patients.

[Tyr0] Corticotropin Releasing Factor, ovine Chemical Structure

[Tyr0] Corticotropin Releasing Factor, ovine Chemical Structure

CAS No. : 83930-34-1

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Top Publications Citing Use of Products
  • Biological Activity

  • References

  • Customer Review

Description

[Tyr0] Corticotropin Releasing Factor, ovine is a corticotropin releasing factor/hormone isolated from ovine. Corticotropin releasing factor (CRF) is a hypothalamic hormone, stimulates the release of adrenocorticotropic hormone (ACTH) and of β-endorphin[1][2].

In Vitro

[Tyr0] Corticotropin Releasing Factor, ovine has a strong binding effect with plasma protein[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

[Tyr0] Corticotropin Releasing Factor, ovine (328 μCi/μg; 198 pg/min or 225 pg/min; continuous infusions intravenous; single dose lasting 5-7 hr) shows a long plasma half-life and low metabolic clearance rate in male cynomolgus monkeys[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Young adult male cynomolgus monkeys (4.0-6.9 kg)[1]
Dosage: 10 mL/h for 198 pg/min or 225 pg/min
Administration: Continuous infusions intravenous; collected every 60 min during 5-7 hr
Result: Showed a longer plasma half-life than for all other known hypothalamic peptides and its metabolic clearance rate was relatively low and considerably less all other known hypothalamic peptides or adreno-cortico-tropic-hormone (ACTH).
Molecular Weight

4833.48

Formula

C214H348N60O65S

CAS No.
Unlabeled CAS

Sequence Shortening

Tyr-Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2

SMILES

[YSQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2]

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

[Tyr0] Corticotropin Releasing Factor, ovine Related Classifications

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
[Tyr0] Corticotropin Releasing Factor, ovine
Cat. No.:
HY-P3687
Quantity:
MCE Japan Authorized Agent: