α-Hemolysin (Staphylococcus aureus) 

α-Hemolysin (Staphylococcus aureus) is one of the most characteristic virulence factors secreted by Staphylococcus aureus, a polypeptide capable of destroying the host cell plasma membrane. After α-Hemolysin binds to the cell surface, its monomers assemble into a homoheptamer to form a front pore, which then transforms into a mature transmembrane pore water channel, allowing K⁺ and Ca²⁺ ion transport, leading to necrotic death of target cells^[1].

α-Hemolysin (Staphylococcus aureus) induces IL-1β secretion and caspase-1 activation in THP-1 cells, and induces IL-1β secretion through activation of NLRP3-inflammasome-dependent caspase-1^[1].
α-Hemolysin (Staphylococcus aureus) (1 µg/mL, 4h) induces THP-derived cell death requiring host NLRP3 signaling but independent of caspase-1 activation and IL-1β secretion^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

28569.06

C_1269H1971N_339O400S₆

94716-94-6

Solid

White to off-white

Ala-Asp-Ser-Asp-Ile-Asn-Ile-Lys-Thr-Gly-Thr-Thr-Asp-Ile-Gly-Ser-Asn-Thr-Thr-Val-Lys-Thr-Gly-Asp-Leu-Val-Thr-Tyr-Asp-Lys-Glu-Asn-Gly-Met-His-Lys-Lys-Val-Phe-Tyr-Ser-Phe-Ile-Asp-Asp-Lys-Asn-Ala-Ile-Lys-Lys-Leu-Leu-Val-Ile-Arg-Thr-Lys-Gly-Thr-Ile-Ala-Gly-Gln-Tyr-Arg-Val-Tyr-Ser-Glu-Glu-Gly-Ala-Asn-Lys-Ser-Gly-Leu-Ala-Trp-Pro-Ser-Ala-Phe-Lys-Val-Gln-Leu-Gln-Leu-Pro-Asp-Asn-Glu-Val-Ala-Glu-Ile-Ser-Asp-Tyr-Tyr-Pro-Arg-Asn-Ser-Ile-Asp-Thr-Lys-Glu-Tyr-Met-Ser-Thr-Leu-Thr-Tyr-Gly-Phe-Asn-Gly-Asn-Val-Thr-Gly-Asp-Asp-Thr-Gly-Lys-Ile-Gly-Gly-Leu-Ile-Gly-Ala-Asn-Val-Ser-Ile-Gly-His-Thr-Leu-Lys-Tyr-Val-Gln-Pro-Asp-Phe-Lys-Thr-Ile-Leu-Glu-Ser-Pro-Thr-Asp-Lys-Lys-Val-Gly-Trp-Lys-Val-Ile-Phe-Asn-Asn-Met-Val-Asn-Gln-Asn-Trp-Gly-Pro-Tyr-Asp-Arg-Asp-Ser-Trp-Asn-Pro-Val-Tyr-Gly-Asn-Gln-Leu-Phe-Met-Lys-Thr-Arg-Asn-Gly-Ser-Met-Lys-Ala-Ala-Asp-Asn-Phe-Leu-Asp-Pro-Asn-Lys-Ala-Ser-Ser-Leu-Leu-Ser-Ser-Gly-Phe-Ser-Pro-Asp-Phe-Ala-Thr-Val-Ile-Thr-Met-Asp-Arg-Lys-Ala-Ser-Lys-Gln-Gln-Thr-Asn-Ile-Asp-Val-Ile-Tyr-Glu-Arg-Val-Arg-Asp-Asp-Tyr-Gln-Leu-His-Trp-Thr-Ser-Thr-Asn-Trp-Lys-Gly-Thr-Asn-Thr-Lys-Asp-Lys-Trp-Thr-Asp-Arg-Ser-Ser-Glu-Arg-Tyr-Lys-Ile-Asp-Trp-Glu-Lys-Glu-Glu-Met-Thr-Asn

ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNAIKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAEISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTN

[a-Hemolysin from Staphylococcus aureus]

Room temperature in continental US; may vary elsewhere.

Sealed storage, away from moisture

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

• [1]. Robin R Craven, et al. Staphylococcus aureus alpha-hemolysin activates the NLRP3-inflammasome in human and mouse monocytic cells. PLoS One. 2009 Oct 14;4(10):e7446.   [Content Brief]